DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and Ncam1

DIOPT Version :10

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:XP_006510118.1 Gene:Ncam1 / 17967 MGIID:97281 Length:1162 Species:Mus musculus


Alignment Length:342 Identity:80/342 - (23%)
Similarity:143/342 - (41%) Gaps:49/342 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 LLLLGNCIDLTVSNKISSVGAFEPDFVIPLENVTIAQGRDATFTCVVNNLGGHRVSGDGSSAPAK 139
            |..||..:.|.|.             ::|.:. .|:.|....|.|        :|:||...  ..
Mouse    11 LFFLGTAVSLQVD-------------IVPSQG-EISVGESKFFLC--------QVAGDAKD--KD 51

  Fly   140 VAWIKADAKAILAIHEHVITNNDRLSVQHNDYNTWTLNIRGVKMEDAGKYMCQVNTDPMKMQTAT 204
            ::|...:.       |.:..|..|:||..||.::.||.|....::|||.|.|.|..:......||
Mouse    52 ISWFSPNG-------EKLSPNQQRISVVWNDDDSSTLTIYNANIDDAGIYKCVVTAEDGTQSEAT 109

  Fly   205 LEVVIPPDIINEETSGDMMVPEGGSAKLVCRARGHPKPKITWRREDGREIIARNGSHQKTKAQSV 269
            :.|.|...::.:.........||..|.:||.......|.|.|:.: ||::|.:    :..:...:
Mouse   110 VNVKIFQKLMFKNAPTPQEFKEGEDAVIVCDVVSSLPPTIIWKHK-GRDVILK----KDVRFIVL 169

  Fly   270 EGEMLTLSKITRSEMGAYMC---IASNGVPPTVSKRMKLQVHFHPLVQVPNQLVGAP--VLTDVT 329
            ....|.:..|.:::.|.|.|   |.:.|  ....|.:::.|:..|.||....:|.|.  :...||
Mouse   170 SNNYLQIRGIKKTDEGTYRCEGRILARG--EINFKDIQVIVNVPPTVQARQSIVNATANLGQSVT 232

  Fly   330 LICNVEASPKAINYWQRENGEMIIAGDRYALTEKENNMYAIEMI-LHIKRLQSSDFGGYKCISKN 393
            |:|:.:..|:....|.:: ||.|...:.    :.|.::::.:.. |.|:.:..:|...|.||::|
Mouse   233 LVCDADGFPEPTMSWTKD-GEPIENEEE----DDEKHIFSDDSSELTIRNVDKNDEAEYVCIAEN 292

  Fly   394 SIGDTEGTIRLYEMERP 410
            ..|:.:.:|.|....:|
Mouse   293 KAGEQDASIHLKVFAKP 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 Ig 98..209 CDD:472250 28/110 (25%)
Ig strand B 115..119 CDD:409353 1/3 (33%)
Ig strand C 139..143 CDD:409353 0/3 (0%)
Ig strand E 174..178 CDD:409353 2/3 (67%)
Ig strand F 188..193 CDD:409353 2/4 (50%)
Ig strand G 202..205 CDD:409353 1/2 (50%)
Ig 211..307 CDD:472250 19/98 (19%)
Ig strand B 230..234 CDD:409353 1/3 (33%)
Ig strand C 243..247 CDD:409353 1/3 (33%)
Ig strand E 272..276 CDD:409353 1/3 (33%)
Ig strand F 286..291 CDD:409353 2/7 (29%)
Ig strand G 300..303 CDD:409353 1/2 (50%)
IG_like 327..405 CDD:214653 19/78 (24%)
Ig strand B 328..332 CDD:409353 3/3 (100%)
Ig strand C 341..346 CDD:409353 1/4 (25%)
Ig strand E 365..376 CDD:409353 1/11 (9%)
Ig strand F 386..391 CDD:409353 2/4 (50%)
Ig strand G 399..402 CDD:409353 0/2 (0%)
Ncam1XP_006510118.1 IgI_1_NCAM-1 20..116 CDD:409451 31/126 (25%)
Ig strand A 20..25 CDD:409451 2/17 (12%)
Ig strand A' 28..32 CDD:409451 0/4 (0%)
Ig strand B 34..44 CDD:409451 3/17 (18%)
Ig strand C 50..56 CDD:409451 1/5 (20%)
Ig strand C' 59..61 CDD:409451 0/8 (0%)
Ig strand D 69..75 CDD:409451 2/5 (40%)
Ig strand E 77..85 CDD:409451 3/7 (43%)
Ig strand F 92..100 CDD:409451 4/7 (57%)
Ig strand G 104..115 CDD:409451 3/10 (30%)
IG_like 124..190 CDD:214653 15/70 (21%)
Ig strand B 135..139 CDD:409353 1/3 (33%)
Ig strand C 148..152 CDD:409353 1/3 (33%)
Ig strand E 172..176 CDD:409353 1/3 (33%)
Ig strand F 186..191 CDD:409353 2/4 (50%)
IgI_3_NCAM-1 211..308 CDD:143207 25/101 (25%)
Ig strand A 211..216 CDD:143207 2/4 (50%)
Ig strand A' 220..226 CDD:143207 2/5 (40%)
Ig strand B 229..239 CDD:143207 4/9 (44%)
Ig strand C 243..249 CDD:143207 1/5 (20%)
Ig strand C' 251..253 CDD:143207 1/1 (100%)
Ig strand D 263..266 CDD:143207 0/2 (0%)
Ig strand E 271..277 CDD:143207 2/5 (40%)
Ig strand F 283..292 CDD:143207 3/8 (38%)
Ig strand G 295..307 CDD:143207 3/11 (27%)
IgI_NCAM-1 307..413 CDD:143277 1/3 (33%)
Ig strand A 307..312 CDD:143277 1/3 (33%)
Ig strand A' 316..320 CDD:143277
Ig strand B 325..333 CDD:143277
Ig strand C 339..345 CDD:143277
Ig strand C' 348..351 CDD:143277
Ig strand D 369..375 CDD:143277
Ig strand E 378..384 CDD:143277
Ig strand F 392..400 CDD:143277
Ig strand G 403..413 CDD:143277
IG_like 422..500 CDD:214653
Ig strand B 433..437 CDD:409353
Ig strand C 446..450 CDD:409353
Ig strand E 473..477 CDD:409353
Ig strand F 487..492 CDD:409353
fn3 512..599 CDD:394996
fn3 649..731 CDD:394996
PHA03247 <905..1140 CDD:223021
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.