DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and zig-8

DIOPT Version :9

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_499714.1 Gene:zig-8 / 176732 WormBaseID:WBGene00006985 Length:268 Species:Caenorhabditis elegans


Alignment Length:165 Identity:40/165 - (24%)
Similarity:67/165 - (40%) Gaps:12/165 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 APAKVAWIKADAKAILAIHEHVITNNDRLSVQHNDYNTWTLNIRGVKMEDAGKYMCQVNTDPMKM 200
            |..::||.:....|:|.......|.:.|..|.....|.|.||:|..:.:|:|.|:|::|.....:
 Worm    63 AEHEIAWTRVSDGALLTAGNRTFTRDPRWQVSKKSANIWVLNLRRAEQQDSGCYLCEINDKHNTV 127

  Fly   201 QTATLEVVIP----PDIINEETSGDMMVPEGGSAKLVCRARGHPKPK----ITWRREDGREIIAR 257
            ....|:|:.|    |..:.::::..|....|....|.|......|.:    :.|.| ||..|...
 Worm   128 YAVYLKV
LEPPLPSPSSLQKKSTKLMANMSGDEVVLNCTVTSTDKDEEVLDVVWTR-DGNTINFN 191

  Fly   258 NGSHQKTKAQSVEG---EMLTLSKITRSEMGAYMC 289
            :......|.:...|   |.:.:.|.|..:.|.|.|
 Worm   192 DTEKYILKVKRDAGVVIETMRIRKATMEDDGNYAC 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 I-set 98..209 CDD:254352 20/72 (28%)
ig 102..195 CDD:278476 17/58 (29%)
IG_like 219..307 CDD:214653 18/78 (23%)
Ig 221..307 CDD:299845 18/76 (24%)
Ig 311..404 CDD:299845
IG_like 327..405 CDD:214653
zig-8NP_499714.1 IG_like 55..134 CDD:214653 19/70 (27%)
Ig 55..129 CDD:143165 18/65 (28%)
ig 158..229 CDD:278476 17/70 (24%)
IG_like 158..227 CDD:214653 17/70 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.