DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and LOC1280937

DIOPT Version :10

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:XP_061518554.1 Gene:LOC1280937 / 1280937 VectorBaseID:AGAMI1_000362 Length:537 Species:Anopheles gambiae


Alignment Length:404 Identity:83/404 - (20%)
Similarity:143/404 - (35%) Gaps:107/404 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 WTLNIRGVKMEDAGKYMCQV--NTDPMKMQTATLEVVIPPDIIN----EETSGDMMVPEGGSAK- 231
            ::|.|..|::.|.|.|.||:  |...:|::   |:::.||..::    .:|..|.:.......| 
Mosquito   138 FSLVIDNVQLTDEGVYSCQLLPNNMTVKIE---LQLLTPPRDVHIMHGSKTINDTIEMHQRDRKV 199

  Fly   232 -LVCRARGHPKPKITWRREDGREIIARNGSHQKTKAQSVEGEMLTLSKITRSEMGAYMCIASNGV 295
             |:|.|.|||.|.|||... ||.:...|......|.:.   |.|.:.::.....|.|.|:|.||:
Mosquito   200 VLLCSAGGHPTPLITWAYR-GRHLDEENSRQLGIKLRK---EFLEIHEVKSQHAGDYECMAQNGI 260

  Fly   296 PPTVSKRMKLQV------------------------HFHPLVQVPNQLVGAPVLTDVTLICNVEA 336
            ...:|:.:.:.|                        ...|::...:..:...:..:|.::|..::
Mosquito   261 GNPISQTVTVVVKDDSSEELEDDYMDDANVTAPPLEKGSPIIHKHSSYINTAIGENVEMVCLYDS 325

  Fly   337 SPKAINYWQRENGEMIIAGDRYALTEKENNMYAIEMILHIKRLQSSDFGGYKC---------ISK 392
            :|:........|.|::.:.....:...:::.:.....|.||.:|..|...|.|         :||
Mosquito   326 NPEPRKIQWIRNDEIVQSVPAQTIITNDHHNHHNRTRLTIKNVQQKDLQAYYCKIENELGEAVSK 390

  Fly   393 NSIGDTEG----------------------------TIRLYEMER----PGKKILRDDDLNEVSK 425
            ..:|.|.|                            .:.||..|.    |....:...|.|....
Mosquito   391 TILGLTPGGAHLIHSNSSDGLLHTWWKIHSIQQISEMLVLYRGENTKYIPVTTEISSHDQNPDGY 455

  Fly   426 NEVVQKDTRSEDG-------SRNLNGRLYKDRAPDQHP---------------ASGSDQLLGRGT 468
            ...::|..|..:|       :||..|....:..|.|..               :||:.:.|..| 
Mosquito   456 TWTIRKSIRLPEGEWFVTARARNTEGWSSAESLPHQFQIRDAMDNIQVASIGGSSGAHRTLSVG- 519

  Fly   469 MRLIGTFLLALLVL 482
                |..||.||||
Mosquito   520 ----GLALLLLLVL 529

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 Ig 98..209 CDD:472250 11/36 (31%)
Ig strand B 115..119 CDD:409353
Ig strand C 139..143 CDD:409353
Ig strand E 174..178 CDD:409353 1/3 (33%)
Ig strand F 188..193 CDD:409353 2/4 (50%)
Ig strand G 202..205 CDD:409353 0/2 (0%)
Ig 211..307 CDD:472250 27/101 (27%)
Ig strand B 230..234 CDD:409353 2/5 (40%)
Ig strand C 243..247 CDD:409353 2/3 (67%)
Ig strand E 272..276 CDD:409353 2/3 (67%)
Ig strand F 286..291 CDD:409353 2/4 (50%)
Ig strand G 300..303 CDD:409353 1/2 (50%)
IG_like 327..405 CDD:214653 17/114 (15%)
Ig strand B 328..332 CDD:409353 1/3 (33%)
Ig strand C 341..346 CDD:409353 0/4 (0%)
Ig strand E 365..376 CDD:409353 1/10 (10%)
Ig strand F 386..391 CDD:409353 2/13 (15%)
Ig strand G 399..402 CDD:409353 1/30 (3%)
LOC1280937XP_061518554.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.