DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and Cd86

DIOPT Version :9

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:XP_006521804.1 Gene:Cd86 / 12524 MGIID:101773 Length:314 Species:Mus musculus


Alignment Length:296 Identity:66/296 - (22%)
Similarity:105/296 - (35%) Gaps:98/296 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 LAIHEHVI-------TNNDRLSVQHNDYNTWTLNIRGVKMEDAGKYMCQVNTDP-----MKMQTA 203
            |.::||.:       .|...|.....|.|.|||.:..|:::|.|.|.|.:...|     :..||.
Mouse    68 LVLYEHYLGTEKLDSVNAKYLGRTSFDRNNWTLRLHNVQIKDMGSYDCFIQKKPPTGSIILQQTL 132

  Fly   204 T-LEVVI---PPDI-INEETSGDMMVPEGGSAKLVCRAR-GHPKPKITWRREDGREIIARNGSHQ 262
            | |.|:.   .|:| :.:..:|:      ....|.|.:: ||||||                   
Mouse   133 TELSVI
ANFSEPEIKLAQNVTGN------SGINLTCTSKQGHPKPK------------------- 172

  Fly   263 KTKAQSVEGEMLTLSKITRSEMGAYMCIASNGVPPTVSKRMKLQVHFHPLVQVPNQLVGAPVLTD 327
                     :|..|...:.:|.|..|.|:.:.|....|....|.:.|      |:.      :..
Mouse   173 ---------KMYFLITNSTNEYGDNMQISQDNVTELFSISNSLSLSF------PDG------VWH 216

  Fly   328 VTLICNVEA-----SPKAIN----------YWQRENGEMIIAGDRYALTEKENNMYAIEMIL--- 374
            :|::|.:|.     |.|.:|          ||:.....:.:|             ..:.|:|   
Mouse   217 MTVVCVLETESMKISSKPLNFTQEFPSPQTYWKEITASVTVA-------------LLLVMLLIIV 268

  Fly   375 -HIKRLQ-SSDFGGYKCISKNSIGDTEGTIRLYEME 408
             |.|..| |........:.::|..|.| ||.|.|:|
Mouse   269 CHKKPNQPSRPSNTASKLERDSNADRE-TINLKELE 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 I-set 98..209 CDD:254352 21/70 (30%)
ig 102..195 CDD:278476 15/50 (30%)
IG_like 219..307 CDD:214653 18/88 (20%)
Ig 221..307 CDD:299845 17/86 (20%)
Ig 311..404 CDD:299845 21/112 (19%)
IG_like 327..405 CDD:214653 20/97 (21%)
Cd86XP_006521804.1 IgV_CD86 33..138 CDD:319336 20/69 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.