DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and HHLA2

DIOPT Version :9

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:XP_011510664.1 Gene:HHLA2 / 11148 HGNCID:4905 Length:425 Species:Homo sapiens


Alignment Length:256 Identity:52/256 - (20%)
Similarity:96/256 - (37%) Gaps:92/256 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 PAIRWQLLLLLLLGNCIDLT--VSNKISSVGAFEPDFVI--PLENVTIAQGRDATFTCVVNNL-- 124
            |.|.|::          |.|  ..|.:...|:.: .|.|  || |:|   |.::::.|.:.|.  
Human   168 PIITWKM----------DNTPISENNMEETGSLD-SFSINSPL-NIT---GSNSSYECTIENSLL 217

  Fly   125 ------------GGHRVSGDGSSAPA-------------KVAW--IKADAKAILAIH----EHVI 158
                        |.|::..:..|...             ||.|  :|:...::||.:    ::.|
Human   218 KQTWTGRWTMKDGLHKMQSEHVSLSCQPVNDYFSPNQDFKVTWSRMKSGTFSVLAYYLSSSQNTI 282

  Fly   159 TNNDRLS-----VQHNDYNTWTLNIRGVKMEDAGKYMCQVNTDPMKMQTATLEVVIPPDIINEET 218
            .|..|.|     :..:|:   ::|:..:.:.|:|:|:|.:::|...:.|.....|.|    ::||
Human   283 INESRFSWNKELINQSDF---SMNLMDLNLSDSGEYLCNISSDEYTLLTIHTVHVEP----SQET 340

  Fly   219 SGD-----MMVPEGGSAKLV-------CRARGHPKPKITWRREDGREIIARNGSHQKTKAQ 267
            :..     ::||....|..:       |||                ::.||...|....||
Human   341 ASHNKGLWILVPSAILAAFLLIWSVKCCRA----------------QLEARRSRHPADGAQ 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 I-set 98..209 CDD:254352 30/150 (20%)
ig 102..195 CDD:278476 27/132 (20%)
IG_like 219..307 CDD:214653 11/61 (18%)
Ig 221..307 CDD:299845 11/59 (19%)
Ig 311..404 CDD:299845
IG_like 327..405 CDD:214653
HHLA2XP_011510664.1 Ig 47..125 CDD:325142
Ig 137..215 CDD:325142 15/61 (25%)
V-set 231..330 CDD:311561 20/101 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.