DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and BTN2A1

DIOPT Version :9

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_008980.1 Gene:BTN2A1 / 11120 HGNCID:1136 Length:527 Species:Homo sapiens


Alignment Length:343 Identity:78/343 - (22%)
Similarity:128/343 - (37%) Gaps:77/343 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 LLLLLLGNCIDLTVSNKISSVGAFEPDFVIPLENVTIAQGRDATFTCVVNNLGGHRVSGDGSSAP 137
            ||||||..|  ..||.:...||        |.:.:....|.:.|..|        .:|.:.::..
Human    15 LLLLLLSLC--ALVSAQFIVVG--------PTDPILATVGENTTLRC--------HLSPEKNAED 61

  Fly   138 AKVAWIKADAKAILAIHEHVITNNDRLSVQHNDYNTWT-------------LNIRGVKMEDAGKY 189
            .:|.|.::.....:.:::   ...:|...|..:|...|             |.|..:..::.|.|
Human    62 MEVRWFRSQFSPAVFVYK---GGRERTEEQMEEYRGRTTFVSKDISRGSVALVIHNITAQENGTY 123

  Fly   190 MCQVNTDPMKMQTATLEVVIPPDIINEETSGDMMVPEGGSAKLVCRARG-HPKPKITWRREDGRE 253
            .|... :......|.|.:|:..  :..:....|...|.|..:|.|.:|| :|||...||...|  
Human   124 RCYFQ-EGRSYDEAILHLVVAG--LGSKPLISMRGHEDGGIRLECISRGWYPKPLTVWRDPYG-- 183

  Fly   254 IIARNGSHQKTKAQSVEGE----MLTLSKITRSEMGAYMCIASNGVPPTVSKRMKLQVHFHPLVQ 314
                 |.....|..|:...    |:|.:.|.|.:....|..:.|.   |:..:.|..|.|.|...
Human   184 -----GVAPALKEVSMPDADGLFMVTTAVIIRDKSVRNMSCSINN---TLLGQKKESVIFIPESF 240

  Fly   315 VPNQ---LVGAPVLTDVTLICNVEASPKAI-NYW----QRENGEMIIAGDR--------YALTEK 363
            :|:.   .|..|::..:.:|      |.|: .||    |:|  :.|::|::        .||.|.
Human   241 MPSVSPCAVALPIIVVILMI------PIAVCIYWINKLQKE--KKILSGEKEFERETREIALKEL 297

  Fly   364 ENNMYAIEMILHIK-RLQ 380
            |......|..|.:| :||
Human   298 EKERVQKEEELQVKEKLQ 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 I-set 98..209 CDD:254352 18/123 (15%)
ig 102..195 CDD:278476 16/105 (15%)
IG_like 219..307 CDD:214653 24/92 (26%)
Ig 221..307 CDD:299845 24/90 (27%)
Ig 311..404 CDD:299845 22/87 (25%)
IG_like 327..405 CDD:214653 18/68 (26%)
BTN2A1NP_008980.1 IG_like 38..142 CDD:214653 17/115 (15%)
Ig_MOG_like 44..143 CDD:143190 18/110 (16%)
SPRY_PRY_BTN1_2 327..500 CDD:293991
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.