DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and BTN3A2

DIOPT Version :9

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:XP_006715042.1 Gene:BTN3A2 / 11118 HGNCID:1139 Length:339 Species:Homo sapiens


Alignment Length:393 Identity:82/393 - (20%)
Similarity:131/393 - (33%) Gaps:95/393 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 LLLLLLLGNCIDLTVSNKISSVGAFEPDFVIPLENVTIAQGRDATFTCVVNNLGGHRVSGDGSSA 136
            |||:.||..|     |.:.|.:|...|        :....|.||...|        .:....|:.
Human    18 LLLVQLLTPC-----SAQFSVLGPSGP--------ILAMVGEDADLPC--------HLFPTMSAE 61

  Fly   137 PAKVAWIKADAKAILAIHEHVITNNDRLSVQHNDYNT----------WTLNIRGVKMEDAGKYMC 191
            ..::.|:.:..:.::.::.......||.|..:....:          ..|.|..|...|:|||:|
Human    62 TMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLC 126

  Fly   192 QV-NTDPMKMQTATLEVVIPPDIINEETSGDMMVPEGGSAKLVCRARG-HPKPKITWRREDGREI 254
            .. :.|..:.....|:|......::.|..|    .|.|...|.||:.| :|:|:|.|....|..|
Human   127 YFQDGDFYEKALVELKVAALGSNLHVEVKG----YEDGGIHLECRSTGWYPQPQIQWSNAKGENI 187

  Fly   255 IARNGSHQKTKAQSVEGEMLTLSKITRSEMG-AYMCIASN---GVPPTVSKRMKLQVHFHPLVQV 315
            .|   ......|..|....:..|.|.|...| ...||..|   |:..|.|..:.......|..:.
Human   188 PA---VEAPVVADGVGLYEVAASVIMRGGSGEGVSCIIRNSLLGLEKTASISIAALPFADPFFRS 249

  Fly   316 PNQLVGA-----PVLTDVTLICNVEASPKAINYWQRENGEMIIAGDRYALTEKENNMYAIEMILH 375
            ....:.|     |:|.                        :::||..|.|..::..:.|:     
Human   250 AQPWIAALAGTLPILL------------------------LLLAGASYFLWRQQKEITAL----- 285

  Fly   376 IKRLQSSDFGGYKCISKNSIGDTEGTIRLYEMERPGKKILRDDDLNEVSKNEVVQKDTRSEDGSR 440
                 ||:....:.:.:.....||..|.|.|            .|.|..|.:.:|..||.|:.|.
Human   286 -----SSEIESEQEMKEMGYAATEREISLRE------------SLQEELKRKKIQYLTRGEESSS 333

  Fly   441 NLN 443
            :.|
Human   334 DTN 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 I-set 98..209 CDD:254352 21/121 (17%)
ig 102..195 CDD:278476 17/103 (17%)
IG_like 219..307 CDD:214653 26/92 (28%)
Ig 221..307 CDD:299845 25/90 (28%)
Ig 311..404 CDD:299845 14/97 (14%)
IG_like 327..405 CDD:214653 10/77 (13%)
BTN3A2XP_006715042.1 IG_like 37..143 CDD:214653 20/121 (17%)
Ig_MOG_like 45..144 CDD:143190 19/106 (18%)
MYO10_CC 277..330 CDD:293340 14/74 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.