Sequence 1: | NP_001138225.1 | Gene: | DIP-beta / 33125 | FlyBaseID: | FBgn0259245 | Length: | 555 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_932079.1 | Gene: | BTNL3 / 10917 | HGNCID: | 1143 | Length: | 466 | Species: | Homo sapiens |
Alignment Length: | 205 | Identity: | 37/205 - (18%) |
---|---|---|---|
Similarity: | 71/205 - (34%) | Gaps: | 58/205 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 112 GRDATFTCVVNNLGGHRVSGDGSSAPAKVAWIKADAKAILAIHEHVITNNDRLSVQHNDYNTWT- 175
Fly 176 ------------LNIRGVKMEDAGKYMCQVNTDPMKMQTATLEVVIPPDIINEETSGDMMVPEGG 228
Fly 229 S-------------AKLVCRARG-HPKPKITWRREDGREIIARNGSHQKTKAQSVEGEMLTLSKI 279
Fly 280 TRSEMGAYMC 289 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
DIP-beta | NP_001138225.1 | I-set | 98..209 | CDD:254352 | 18/109 (17%) |
ig | 102..195 | CDD:278476 | 18/95 (19%) | ||
IG_like | 219..307 | CDD:214653 | 16/85 (19%) | ||
Ig | 221..307 | CDD:299845 | 16/83 (19%) | ||
Ig | 311..404 | CDD:299845 | |||
IG_like | 327..405 | CDD:214653 | |||
BTNL3 | NP_932079.1 | Ig_MOG_like | 33..132 | CDD:319291 | 21/125 (17%) |
SPRY_PRY_C-I_1 | 289..461 | CDD:293968 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |