DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and BTNL3

DIOPT Version :9

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_932079.1 Gene:BTNL3 / 10917 HGNCID:1143 Length:466 Species:Homo sapiens


Alignment Length:205 Identity:37/205 - (18%)
Similarity:71/205 - (34%) Gaps:58/205 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 GRDATFTCVVNNLGGHRVSGDGSSAPAKVAWIKADAKAILAIHEHVITNNDRLSVQHNDYNTWT- 175
            |.||.|:|        .:..:.|:...:|.:.:....|::.::.   ...|..|.|...|...| 
Human    33 GEDAVFSC--------SLFPETSAEAMEVRFFRNQFHAVVHLYR---DGEDWESKQMPQYRGRTE 86

  Fly   176 ------------LNIRGVKMEDAGKYMCQVNTDPMKMQTATLEVVIPPDIINEETSGDMMVPEGG 228
                        |.::.:...|.|.|.|..::                .|.:||.:.::.|...|
Human    87 FVKDSIAGGRVSLRLKNITPSDIGLYGCWFSS----------------QIYDEEATWELRVAALG 135

  Fly   229 S-------------AKLVCRARG-HPKPKITWRREDGREIIARNGSHQKTKAQSVEGEMLTLSKI 279
            |             .:|:|.:.| .|:|...|:...|:::    .|..:..|.......:.:|.|
Human   136 SLPLISIVGYVDGGIQLLCLSSGWFPQPTAKWKGPQGQDL----SSDSRANADGYSLYDVEISII 196

  Fly   280 TRSEMGAYMC 289
            .:...|:.:|
Human   197 VQENAGSILC 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 I-set 98..209 CDD:254352 18/109 (17%)
ig 102..195 CDD:278476 18/95 (19%)
IG_like 219..307 CDD:214653 16/85 (19%)
Ig 221..307 CDD:299845 16/83 (19%)
Ig 311..404 CDD:299845
IG_like 327..405 CDD:214653
BTNL3NP_932079.1 Ig_MOG_like 33..132 CDD:319291 21/125 (17%)
SPRY_PRY_C-I_1 289..461 CDD:293968
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.