DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and CHL1

DIOPT Version :10

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_006605.2 Gene:CHL1 / 10752 HGNCID:1939 Length:1224 Species:Homo sapiens


Alignment Length:378 Identity:86/378 - (22%)
Similarity:129/378 - (34%) Gaps:104/378 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 VSNKISSVGAFEPDFVIP------LENVTIAQGRDATFTCVV----------NNLGGHRVSGDGS 134
            :.:|.:|:...:|..::|      ..::||.:|......|..          |.:||....|..:
Human   239 IGSKANSIKQRKPKLLLPPTESGSESSITILKGEILLLECFAEGLPTPQVDWNKIGGDLPKGRET 303

  Fly   135 SAPAKVAWIKADAKAILAIHEHVITNNDRLSVQHNDYNTWTLNIRGVKMEDAGKYMCQVNTDPMK 199
            .                                 .:|.. ||.|..|..:|.|.|.|   |....
Human   304 K---------------------------------ENYGK-TLKIENVSYQDKGNYRC---TASNF 331

  Fly   200 MQTAT--LEVVI--PPDIINEETSGDMMVPEGGSAKLVCRARGHPKPKITWRREDGREIIARNGS 260
            :.|||  ..|::  ||....:..|.  :...|.:..|:|.|.|.|:|.|.||         .|||
Human   332 LGTATHDFHVIVEEPPRWTKKPQSA--VYSTGSNGILLCEAEGEPQPTIKWR---------VNGS 385

  Fly   261 ---HQKTKAQSVEGEMLTLSKITRSEMGAYMCIASNGVPPTVSKRMKLQ-VHFHPLVQVPN---- 317
               :.......|....::.:.:..:....|.|.||| |..|:.....:. |...||:|..:    
Human   386 PVDNHPFAGDVVFPREISFTNLQPNHTAVYQCEASN-VHGTILANANIDVVDVRPLIQTKDGENY 449

  Fly   318 -QLVGAPVLTDVTLICNVEASPKAINYWQRENGEMIIAGDRYALTEKENNMYAIEMILHIKRLQS 381
             .:||....    |.|...|||:|:..||:......:.|.||.:.|...        |.|.|...
Human   450 ATVVGYSAF----LHCEFFASPEAVVSWQKVEEVKPLEGRRYHIYENGT--------LQINRTTE 502

  Fly   382 SDFGGYKCISKNSIGDTEGTIRLYEMERPGKKILRDDDLNEVSKNEVVQKDTR 434
            .|.|.|.|..:|:||.|..|..|              |:...:|..|..|:.|
Human   503 EDAGSYSCWVENAIGKTAVTANL--------------DIRNATKLRVSPKNPR 541

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 Ig 98..209 CDD:472250 24/128 (19%)
Ig strand B 115..119 CDD:409353 0/3 (0%)
Ig strand C 139..143 CDD:409353 0/3 (0%)
Ig strand E 174..178 CDD:409353 2/3 (67%)
Ig strand F 188..193 CDD:409353 2/4 (50%)
Ig strand G 202..205 CDD:409353 3/4 (75%)
Ig 211..307 CDD:472250 23/99 (23%)
Ig strand B 230..234 CDD:409353 1/3 (33%)
Ig strand C 243..247 CDD:409353 1/3 (33%)
Ig strand E 272..276 CDD:409353 0/3 (0%)
Ig strand F 286..291 CDD:409353 2/4 (50%)
Ig strand G 300..303 CDD:409353 0/2 (0%)
IG_like 327..405 CDD:214653 24/77 (31%)
Ig strand B 328..332 CDD:409353 1/3 (33%)
Ig strand C 341..346 CDD:409353 1/4 (25%)
Ig strand E 365..376 CDD:409353 1/10 (10%)
Ig strand F 386..391 CDD:409353 2/4 (50%)
Ig strand G 399..402 CDD:409353 0/2 (0%)
CHL1NP_006605.2 Ig 35..126 CDD:472250
Ig strand B 53..57 CDD:409396
Ig strand C 66..70 CDD:409396
Ig strand E 90..94 CDD:409396
Ig strand F 106..111 CDD:409396
Ig strand G 120..123 CDD:409396
IgI_2_L1-CAM_like 135..225 CDD:409432
Ig strand A 135..138 CDD:409432
Ig strand A' 140..144 CDD:409432
Ig strand B 147..155 CDD:409432
Ig strand C 162..168 CDD:409432
Ig strand C' 171..174 CDD:409432
Ig strand D 180..184 CDD:409432
Ig strand E 186..190 CDD:409432
Ig strand F 201..209 CDD:409432
Ig strand G 212..225 CDD:409432
Ig3_L1-CAM_like 262..344 CDD:409394 22/118 (19%)
Ig strand B 274..278 CDD:409394 0/3 (0%)
Ig strand C 287..291 CDD:409394 0/3 (0%)
Ig strand E 309..313 CDD:409394 2/4 (50%)
Ig strand F 323..328 CDD:409394 2/7 (29%)
Ig strand G 336..339 CDD:409394 1/2 (50%)
Ig4_L1-NrCAM_like 348..435 CDD:409367 22/98 (22%)
Ig strand B 364..368 CDD:409367 1/3 (33%)
Ig strand C 377..381 CDD:409367 1/3 (33%)
Ig strand E 400..404 CDD:409367 0/3 (0%)
Ig strand F 414..419 CDD:409367 2/4 (50%)
Ig strand G 427..430 CDD:409367 0/2 (0%)
Ig 448..525 CDD:472250 26/88 (30%)
Ig strand B 457..461 CDD:409390 1/7 (14%)
Ig strand C 470..474 CDD:409390 0/3 (0%)
Ig strand E 493..497 CDD:409390 1/11 (9%)
Ig strand F 507..512 CDD:409390 2/4 (50%)
Ig strand G 520..523 CDD:409390 0/2 (0%)
Ig 548..617 CDD:409353
Ig strand B 548..552 CDD:409353
Ig strand C 565..569 CDD:409353
DGEA 571..574
Ig strand E 590..594 CDD:409353
Ig strand F 604..609 CDD:409353
FN3 <616..>868 CDD:442628
FN3 628..717 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 709..732
FN3 834..927 CDD:238020
FN3 932..1027 CDD:238020
Bravo_FIGEY 1120..1205 CDD:464016
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1147..1179
FIG[AQ]Y 1197..1201
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1205..1224
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.