DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and ntm

DIOPT Version :10

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:XP_004916061.1 Gene:ntm / 100492453 XenbaseID:XB-GENE-6045425 Length:374 Species:Xenopus tropicalis


Alignment Length:316 Identity:97/316 - (30%)
Similarity:149/316 - (47%) Gaps:56/316 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 LENVTIAQGRDATFTCVVNNLGGHRVSGDGSSAPAKVAWIKADAKAILAIHEHVITNNDRLSVQ- 167
            ::|||:.||..|...|.|:|    ||:        :|||:  :...||      .|.||:.|:. 
 Frog    43 MDNVTVRQGDSAILRCTVDN----RVT--------RVAWL--NRSTIL------YTGNDKWSIDP 87

  Fly   168 -----HNDYNTWTLNIRGVKMEDAGKYMCQVNTD--PMKMQTATLEVVIPPDIINEETSGDMMVP 225
                 .|..:.:::.|:.|.:.|.|.|.|.|.||  | |.....|.|.:||.|:  :.|..:.|.
 Frog    88 RVVLLANTKSQYSIEIQNVDIYDEGPYTCSVQTDNHP-KTSRVHLIVQVPPRIV--DISSSIAVN 149

  Fly   226 EGGSAKLVCRARGHPKPKITWRREDGREIIARNGSHQKTKAQSV--EGEMLTLSKITRSEMGAYM 288
            ||.:..|:|.|.|.|:|.:.||             :...||:..  |.|.|.::.|||.:.|.|.
 Frog   150 EGSNVSLICIANGRPEPVVNWR-------------YLSPKARGFVSEDEYLEITGITREQSGIYE 201

  Fly   289 CIASNGVPPTVSKRMKLQVHFHPLVQVPNQLVGAPVLTDVTLICNVEASPKAINYWQRENGEMII 353
            |.|||.|.....:|:||.|::.|.: :..|.:|||:.....|.|...|.|.|..:|.:|:..:  
 Frog   202 CSASNDVSAPDVRRVKLTVNYPPYI-LDAQNIGAPLGHRGILQCEASAVPAADFFWYKEDKRL-- 263

  Fly   354 AGDRYALTEKENNMYAIEMILHIKRLQSS--DFGGYKCISKNSIGDTEGTIRLYEM 407
             .|.:...:.||.    |.|..:..|..|  |:|.|.|::||.:|.:..:|.|:|:
 Frog   264 -SDSWRGVKVENR----ETISRVTFLNVSEQDYGNYTCMAKNLLGHSNASIILFEL 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 Ig 98..209 CDD:472250 34/112 (30%)
Ig strand B 115..119 CDD:409353 1/3 (33%)
Ig strand C 139..143 CDD:409353 2/3 (67%)
Ig strand E 174..178 CDD:409353 0/3 (0%)
Ig strand F 188..193 CDD:409353 2/4 (50%)
Ig strand G 202..205 CDD:409353 0/2 (0%)
Ig 211..307 CDD:472250 32/97 (33%)
Ig strand B 230..234 CDD:409353 1/3 (33%)
Ig strand C 243..247 CDD:409353 0/3 (0%)
Ig strand E 272..276 CDD:409353 2/3 (67%)
Ig strand F 286..291 CDD:409353 2/4 (50%)
Ig strand G 300..303 CDD:409353 0/2 (0%)
IG_like 327..405 CDD:214653 22/79 (28%)
Ig strand B 328..332 CDD:409353 1/3 (33%)
Ig strand C 341..346 CDD:409353 1/4 (25%)
Ig strand E 365..376 CDD:409353 3/10 (30%)
Ig strand F 386..391 CDD:409353 2/4 (50%)
Ig strand G 399..402 CDD:409353 0/2 (0%)
ntmXP_004916061.1 Ig 45..133 CDD:472250 33/108 (31%)
Ig strand B 54..58 CDD:409353 1/3 (33%)
Ig strand C 66..70 CDD:409353 2/3 (67%)
Ig strand E 99..103 CDD:409353 0/3 (0%)
Ig strand F 113..118 CDD:409353 2/4 (50%)
Ig strand G 126..129 CDD:409353 0/2 (0%)
Ig_3 136..206 CDD:464046 27/84 (32%)
ig 227..311 CDD:395002 26/90 (29%)
Ig strand B 240..244 CDD:409353 1/3 (33%)
Ig strand C 253..257 CDD:409353 0/3 (0%)
Ig strand E 279..283 CDD:409353 0/3 (0%)
Ig strand F 293..298 CDD:409353 2/4 (50%)

Return to query results.
Submit another query.