DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and adgrl1.1

DIOPT Version :9

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:XP_002660669.2 Gene:adgrl1.1 / 100334775 ZFINID:ZDB-GENE-130116-2 Length:390 Species:Danio rerio


Alignment Length:283 Identity:64/283 - (22%)
Similarity:102/283 - (36%) Gaps:77/283 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   274 LTLSKITRSEMGAYMCIASNGV---PPTVSKRMKLQVHFHPLV------------QVPNQLVGAP 323
            |..:.:|.|.:...:|....||   |.|.:.|:...|.|...|            ::.||.:|..
Zfish     4 LQTAALTFSALLCAVCAQGPGVSVRPRTAAVRLGETVSFQHRVTSRAQPGMLESGKMNNQTLGVF 68

  Fly   324 VLTDVTLICNVEASPKAINYWQRENG----EMIIAGDR-YALTEKENNMYAIEMILHIKR----L 379
            |... ||:..:|  |.::...:..:|    :.:.|||| |.:..   ..|..:|:.....    :
Zfish    69 VCPG-TLVRVLE--PSSVREAEDHSGAWCKDPLQAGDRLYVMPW---TPYRTDMLYEYASWDDYI 127

  Fly   380 QSSDFGGYKCISKNSIGDT-----EGTIRLYEMERPGKKILRDDDLNEVSKNEVVQKDTRSEDGS 439
            |:.....||..|:  :..|     :|.: .|..||. :.|::.|....:...|.|..:....|.|
Zfish   128 QNRVTTTYKLPSR--VDGTGFVVYDGAV-FYNKERT-RNIVKYDLRTRIKSGEAVIVNANYHDAS 188

  Fly   440 -RNLNGRLYKDRAPDQHPASGSDQLLGRGTMRLIGTFLLALLVLFTALAEAG--------PTTLS 495
             .:..|:...|.|.|:|                      .|.|::|..|..|        |.|| 
Zfish   189 PYHRGGKSDIDLAVDEH----------------------GLWVIYTTEANNGRLVVSQVNPYTL- 230

  Fly   496 CRTKGGRQKKAKETSWNGRRARD 518
             |.:|..|     ||:..|.|.|
Zfish   231 -RFEGTWQ-----TSFEKRMASD 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 I-set 98..209 CDD:254352
ig 102..195 CDD:278476
IG_like 219..307 CDD:214653 9/35 (26%)
Ig 221..307 CDD:299845 9/35 (26%)
Ig 311..404 CDD:299845 23/118 (19%)
IG_like 327..405 CDD:214653 18/91 (20%)
adgrl1.1XP_002660669.2 OLF 72..328 CDD:295358 48/215 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.