DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and sc:d0835

DIOPT Version :9

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_001108578.1 Gene:sc:d0835 / 100141489 ZFINID:ZDB-GENE-080229-5 Length:286 Species:Danio rerio


Alignment Length:329 Identity:58/329 - (17%)
Similarity:109/329 - (33%) Gaps:104/329 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 QLLLLLLLGNCIDLTVSNKISSVGAFEPDFVIPLENVTIAQGRDATFTCVVN-NLGGHRVSGDGS 134
            ::.:..|:.:.|.::.|.....|...:|.|.:        .|.||...|.:. |:         :
Zfish     8 EMFICFLILSGITISESEGYELVRVADPVFAV--------VGGDAILPCSIKPNI---------T 55

  Fly   135 SAPAKVAWIKADAKAILAIH---EHVITNNDRLSVQHNDYNTWT-------------LNIRGVKM 183
            ....||.|::.|.:..:.:|   :|    .||::.|...|...|             |.:..|:.
Zfish    56 IVDMKVEWVRLDQEHSVVVHLYEDH----EDRIAEQIQSYRGRTELNPQELQRGNAALKLISVQE 116

  Fly   184 EDAGKYMCQVNTDPMKMQT---ATLEVVIPPDIINEETSGDMMVPEGGSAKLVCRARG-HPKPKI 244
            .|.|.|.|.:::....:.|   ..:|.|..|.:|..:..      ..|...|.|.:.| :|:|.:
Zfish   117 SDEGVYKCFIHSTSWSIDTNINVKVEAVGSPPVITVDGF------NSGGLNLQCESEGWYPEPDL 175

  Fly   245 TWRREDGREIIARNGSHQKTKAQSVEGEMLTLSKITRSEMGAYMCIASNGVPPTVSKRMKLQVHF 309
            .|          .:|...:...::.|      :...|........|:.......:..|:||:.|.
Zfish   176 EW----------LDGKRTRLNPETTE------THRNRDGFSVKQTISVGHKDGKIHCRVKLRDHL 224

  Fly   310 HPLVQVPNQLVGAPVLTDVTLICNVEASPK-----------AINYW---------------QREN 348
                          :.|.:.:.||:..|.|           .|:.|               :.::
Zfish   225 --------------LETQIVISCNMFKSSKISFIVIAVACIGISIWIIYKYIAHRKLQSQIKIQD 275

  Fly   349 GEMI 352
            ||:|
Zfish   276 GELI 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 I-set 98..209 CDD:254352 26/130 (20%)
ig 102..195 CDD:278476 22/109 (20%)
IG_like 219..307 CDD:214653 14/88 (16%)
Ig 221..307 CDD:299845 14/86 (16%)
Ig 311..404 CDD:299845 10/68 (15%)
IG_like 327..405 CDD:214653 9/52 (17%)
sc:d0835NP_001108578.1 IG_like 38..141 CDD:214653 23/123 (19%)
Ig 41..141 CDD:299845 23/112 (21%)
Ig 142..223 CDD:299845 18/102 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.