DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and hmcn1

DIOPT Version :10

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:XP_012816895.2 Gene:hmcn1 / 100135378 XenbaseID:XB-GENE-6258572 Length:5519 Species:Xenopus tropicalis


Alignment Length:514 Identity:127/514 - (24%)
Similarity:196/514 - (38%) Gaps:130/514 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SCSQEHTTK--FSPKLSQVAKHRKLAQLEIASGSG--------------LVGLGTGTGTGSGCGP 66
            |..:::|.|  ..|.:|:...|.  :::.:..|:.              |..|..|....||.|.
 Frog  2276 SAMKKYTVKVYVRPSISESGNHP--SEIVVIQGNNVTLECDARGDPQPMLTWLKEGIPLISGNGF 2338

  Fly    67 AIRWQLLLLLL----LGN-----CIDLTVSN--------KISSVGAFEPDFVIPLENVTIAQGRD 114
            .|.....||.|    :.|     |:.:.|:.        |:....|| ||.::..||::|.:...
 Frog  2339 EISSNGRLLHLQKAQISNAGLYVCVAVNVAGQSDRKYDLKVFVPPAF-PDGIMKHENISIVEKNP 2402

  Fly   115 ATFTCVVNNLGGHRVSGDGSSAPAKVAWIKADAKAILAIHEHVITNNDRLSVQHNDYNTWTLNIR 179
            .|.||.|:.:           .|.||.|.| |...|.......|.:...|           |...
 Frog  2403 FTLTCEVSGI-----------PPPKVTWYK-DGNPIPPSRSPQIMSGGFL-----------LRFS 2444

  Fly   180 GVKMEDAGKYMCQV-NTDPMKMQTATLEVVIPPDI---INEETSGDMMVPEGGSAKLVCRARGHP 240
            ...:.|.|:|.|.| |.....|:...:.|::||.|   :.||    :.|.|.|:..|.|.|.|.|
 Frog  2445 QSSLSDTGRYTCAVSNAAGEDMRKFDVNVLVPPKITGSVQEE----IKVKERGNITLSCEATGTP 2505

  Fly   241 KPKITWRREDGREIIARNGSHQKTKAQSVEGEMLTLSKITRSEMGAYMCIASNGVPPTVSKRMKL 305
            .|:|||.: ||..::.........|.|     :|.:|.:..::.|.|:|:|||..... |:...|
 Frog  2506 IPQITWLK-DGHPVLEDTNHRIDHKRQ-----LLRISNVMMTDSGRYVCVASNPAGER-SRSFSL 2563

  Fly   306 QVHFHPLVQVPNQLVGAP------VLTDVTLICNVEASPKAINYWQRE-------NGEMIIAGDR 357
            .|...|.::  ..:.|:|      :|:.::|.|.|.:.|.|...|.::       :...|:.|.|
 Frog  2564 GVLISPTIK--GAINGSPEDVKVVLLSSISLECEVHSHPPATITWHKDGRLFKFKDNVRILPGGR 2626

  Fly   358 YALTEKENNMYAIEMILHIKRLQSSDFGGYKCISKNSIGDTEGTIRL-YEMERPGKKILRDDDLN 421
                           .|.|.:.|..|.|.|.||:.|..|  |||... ..:..|.|  :|.||::
 Frog  2627 ---------------TLQILKAQEKDAGRYSCIATNEAG--EGTHHYNLNVHIPPK--IRKDDIS 2672

  Fly   422 E-----------VSKNEVVQKDTRSEDGSRNLNGRL--YKD---RAPDQHPASGSDQLL 464
            |           |:.|..:..|.::     |...::  |||   ..||.|.|..|...|
 Frog  2673 EFGGFSKEIKAIVNTNFTLVCDVKA-----NPLAKITWYKDGQPLEPDSHLAIVSGNTL 2726

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 Ig 98..209 CDD:472250 27/111 (24%)
Ig strand B 115..119 CDD:409353 1/3 (33%)
Ig strand C 139..143 CDD:409353 2/3 (67%)
Ig strand E 174..178 CDD:409353 1/3 (33%)
Ig strand F 188..193 CDD:409353 2/4 (50%)
Ig strand G 202..205 CDD:409353 0/2 (0%)
Ig 211..307 CDD:472250 30/98 (31%)
Ig strand B 230..234 CDD:409353 1/3 (33%)
Ig strand C 243..247 CDD:409353 2/3 (67%)
Ig strand E 272..276 CDD:409353 1/3 (33%)
Ig strand F 286..291 CDD:409353 2/4 (50%)
Ig strand G 300..303 CDD:409353 1/2 (50%)
IG_like 327..405 CDD:214653 22/85 (26%)
Ig strand B 328..332 CDD:409353 1/3 (33%)
Ig strand C 341..346 CDD:409353 1/4 (25%)
Ig strand E 365..376 CDD:409353 1/10 (10%)
Ig strand F 386..391 CDD:409353 2/4 (50%)
Ig strand G 399..402 CDD:409353 2/2 (100%)
hmcn1XP_012816895.2 vWFA 43..199 CDD:238119
MD 295..418 CDD:214741
IG_like 446..517 CDD:214653
Ig strand B 449..452 CDD:409353
Ig strand C 461..465 CDD:409353
Ig strand E 483..487 CDD:409353
Ig strand F 497..502 CDD:409353
Ig strand G 511..514 CDD:409353
Ig 521..608 CDD:472250
Ig strand B 538..542 CDD:409353
Ig strand C 551..555 CDD:409353
Ig strand E 575..579 CDD:409353
Ig strand F 589..594 CDD:409353
Ig strand G 602..605 CDD:409353
I-set 613..691 CDD:400151
Ig strand B 630..634 CDD:409353
Ig strand C 643..647 CDD:409353
Ig strand E 665..669 CDD:409353
Ig strand F 679..684 CDD:409353
Ig strand G 693..696 CDD:409353
Ig_3 703..777 CDD:464046
I-set 794..885 CDD:400151
Ig strand B 811..815 CDD:409353
Ig strand C 824..834 CDD:409353
Ig strand E 851..855 CDD:409353
Ig strand F 865..870 CDD:409353
Ig strand G 878..881 CDD:409353
Ig_3 891..965 CDD:464046
PHA02785 991..1258 CDD:165149
Ig 1268..1355 CDD:472250
Ig strand B 1284..1288 CDD:409353
Ig strand C 1297..1301 CDD:409353
Ig strand E 1321..1325 CDD:409353
Ig strand F 1335..1340 CDD:409353
Ig strand G 1348..1351 CDD:409353
Ig 1366..1448 CDD:472250
Ig strand B 1378..1382 CDD:143222
Ig strand C 1391..1395 CDD:143222
Ig strand E 1413..1418 CDD:143222
Ig strand F 1428..1433 CDD:143222
Ig strand G 1442..1445 CDD:143222
I-set 1457..1542 CDD:400151
Ig strand B 1471..1475 CDD:409353
Ig strand C 1484..1488 CDD:409353
Ig strand E 1507..1512 CDD:409353
Ig strand F 1522..1527 CDD:409353
Ig strand G 1535..1538 CDD:409353
Ig 1565..1629 CDD:472250
Ig strand B 1565..1569 CDD:409353
Ig strand C 1578..1582 CDD:409353
Ig strand E 1601..1605 CDD:409353
Ig strand F 1615..1620 CDD:409353
I-set 1649..1729 CDD:400151
Ig strand B 1659..1663 CDD:409353
Ig strand C 1672..1676 CDD:409353
Ig strand E 1695..1699 CDD:409353
Ig strand F 1709..1714 CDD:409353
Ig strand G 1722..1725 CDD:409353
I-set 1741..1822 CDD:400151
Ig strand B 1752..1756 CDD:409353
Ig strand C 1765..1769 CDD:409353
Ig strand E 1787..1792 CDD:409353
Ig strand F 1802..1807 CDD:409353
Ig <1844..1914 CDD:472250
Ig strand B 1844..1847 CDD:409353
Ig strand C 1856..1860 CDD:409353
Ig strand E 1880..1884 CDD:409353
Ig strand F 1894..1899 CDD:409353
Ig strand G 1907..1910 CDD:409353
Ig 1937..2007 CDD:472250
Ig strand B 1937..1941 CDD:409353
Ig strand C 1950..1954 CDD:409353
Ig strand E 1973..1977 CDD:409353
Ig strand F 1987..1992 CDD:409353
I-set 2011..2099 CDD:400151
Ig strand B 2028..2032 CDD:143207
Ig strand C 2041..2045 CDD:143207
Ig strand E 2065..2069 CDD:143207
Ig strand F 2079..2084 CDD:143207
Ig strand G 2092..2095 CDD:143207
Ig_3 2102..2177 CDD:464046
Ig 2194..2285 CDD:472250 2/8 (25%)
Ig strand B 2213..2217 CDD:409353
Ig strand C 2226..2230 CDD:409353
Ig strand E 2251..2255 CDD:409353
Ig strand F 2265..2270 CDD:409353
Ig strand G 2278..2281 CDD:409353 0/2 (0%)
Ig 2298..2369 CDD:472250 14/72 (19%)
Ig strand B 2309..2313 CDD:409353 0/3 (0%)
Ig strand C 2322..2326 CDD:409353 1/3 (33%)
Ig strand E 2344..2349 CDD:409353 2/4 (50%)
Ig strand F 2359..2364 CDD:409353 1/4 (25%)
Ig strand B 2403..2407 CDD:409353 1/3 (33%)
Ig 2404..2473 CDD:472250 21/91 (23%)
Ig strand C 2416..2420 CDD:409353 2/3 (67%)
Ig strand E 2439..2443 CDD:409353 2/14 (14%)
Ig strand F 2453..2458 CDD:409353 2/4 (50%)
I-set 2477..2565 CDD:400151 30/98 (31%)
Ig strand B 2495..2499 CDD:409353 1/3 (33%)
Ig strand C 2508..2512 CDD:409353 2/3 (67%)
Ig strand E 2531..2535 CDD:409353 2/8 (25%)
Ig strand F 2545..2550 CDD:409353 2/4 (50%)
Ig 2579..2660 CDD:472250 24/97 (25%)
Ig strand B 2590..2594 CDD:409353 1/3 (33%)
Ig strand C 2603..2607 CDD:409353 0/3 (0%)
Ig strand E 2626..2630 CDD:409353 2/18 (11%)
Ig strand F 2640..2645 CDD:409353 2/4 (50%)
Ig strand G 2653..2656 CDD:409353 1/2 (50%)
I-set 2673..2758 CDD:400151 14/59 (24%)
Ig strand B 2689..2693 CDD:409353 0/3 (0%)
Ig strand C 2702..2706 CDD:409353 0/3 (0%)
Ig strand E 2725..2728 CDD:409353 1/2 (50%)
Ig strand F 2738..2743 CDD:409353
Ig strand B 2794..2798 CDD:409353
Ig 2795..2857 CDD:472250
Ig strand C 2807..2811 CDD:409353
Ig strand E 2830..2834 CDD:409353
Ig strand F 2844..2849 CDD:409353
I-set 2878..2961 CDD:400151
Ig strand C 2904..2908 CDD:409353
Ig strand E 2926..2931 CDD:409353
Ig strand F 2941..2946 CDD:409353
Ig 2974..3051 CDD:472250
Ig strand B 2983..2987 CDD:409353
Ig strand C 2996..3000 CDD:409353
Ig strand E 3018..3023 CDD:409353
Ig strand F 3033..3038 CDD:409353
Ig strand G 3046..3049 CDD:409353
I-set 3070..3148 CDD:400151
Ig strand B 3078..3082 CDD:143207
Ig strand C 3091..3095 CDD:143207
Ig strand E 3114..3118 CDD:143207
Ig strand F 3128..3133 CDD:143207
Ig strand G 3141..3144 CDD:143207
Ig 3169..3242 CDD:472250
Ig strand B 3170..3174 CDD:409353
Ig strand C 3183..3187 CDD:409353
Ig strand E 3208..3212 CDD:409353
Ig strand F 3222..3227 CDD:409353
I-set 3259..3329 CDD:400151
Ig strand B 3265..3269 CDD:143207
Ig strand C 3278..3282 CDD:143207
Ig strand E 3303..3307 CDD:143207
Ig strand F 3317..3322 CDD:143207
Ig strand G 3330..3333 CDD:143207
I-set 3341..3431 CDD:400151
Ig strand B 3361..3365 CDD:409353
Ig strand C 3374..3378 CDD:409353
Ig strand E 3397..3401 CDD:409353
Ig strand F 3411..3416 CDD:409353
Ig 3444..3524 CDD:472250
Ig strand B 3454..3458 CDD:409353
Ig strand C 3467..3471 CDD:409353
Ig strand E 3489..3494 CDD:409353
Ig strand F 3504..3509 CDD:409353
Ig strand G 3517..3520 CDD:409353
Ig 3539..3617 CDD:472250
Ig strand B 3547..3551 CDD:143207
Ig strand C 3560..3564 CDD:143207
Ig strand E 3583..3587 CDD:143207
Ig strand F 3597..3602 CDD:143207
Ig strand G 3610..3613 CDD:143207
I-set 3630..3710 CDD:400151
Ig strand B 3640..3644 CDD:409353
Ig strand C 3653..3657 CDD:409353
Ig strand E 3675..3680 CDD:409353
Ig strand F 3690..3695 CDD:409353
Ig_3 3713..3788 CDD:464046
Ig_3 3804..3879 CDD:464046
Ig 3908..3985 CDD:472250
Ig strand B 3915..3919 CDD:409353
Ig strand C 3928..3932 CDD:409353
Ig strand E 3951..3955 CDD:409353
Ig strand F 3965..3970 CDD:409353
Ig strand G 3978..3981 CDD:409353
I-set 3989..4075 CDD:400151
Ig strand B 4006..4010 CDD:409353
Ig strand C 4019..4023 CDD:409353
Ig strand E 4041..4045 CDD:409353
Ig strand F 4055..4060 CDD:409353
Ig strand G 4068..4071 CDD:409353
Ig_3 4078..4152 CDD:464046
I-set 4169..4256 CDD:400151
Ig strand B 4186..4190 CDD:409353
Ig strand C 4199..4203 CDD:409353
Ig strand E 4222..4226 CDD:409353
Ig strand F 4236..4241 CDD:409353
Ig strand G 4249..4252 CDD:409353
Ig_3 4259..4333 CDD:464046
Ig 4358..4436 CDD:472250
Ig strand B 4368..4372 CDD:409353
Ig strand C 4381..4385 CDD:409353
Ig strand E 4403..4407 CDD:409353
Ig strand F 4417..4422 CDD:409353
Ig strand G 4430..4433 CDD:409353
Ig 4443..4527 CDD:472250
Ig strand B 4458..4462 CDD:409353
Ig strand C 4471..4475 CDD:409353
Ig strand E 4493..4497 CDD:409353
Ig strand F 4507..4512 CDD:409353
Ig strand G 4520..4523 CDD:409353
TSP1 4534..4585 CDD:214559
TSP1 4590..4642 CDD:214559
TSP1 4647..4699 CDD:214559
TSP1 4704..4756 CDD:214559
TSP1 4761..4813 CDD:214559
TSP1 4818..4870 CDD:214559
nidG2 4869..5093 CDD:469646
cEGF 5130..5151 CDD:463661
EGF_CA 5148..5183 CDD:214542
EGF_CA 5193..5230 CDD:214542
EGF_CA 5231..5272 CDD:214542
EGF_CA 5273..>5305 CDD:214542
EGF_CA 5316..5355 CDD:214542
EGF_CA 5356..>5391 CDD:214542
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.