DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and negr1

DIOPT Version :9

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:XP_031755650.1 Gene:negr1 / 100127726 XenbaseID:XB-GENE-987949 Length:388 Species:Xenopus tropicalis


Alignment Length:450 Identity:105/450 - (23%)
Similarity:181/450 - (40%) Gaps:103/450 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 GSGCGPAIRWQLLLLL----LLGNCIDLTVSNKISSVGAFEPDFVIP-LENVTIAQGRDATFTCV 120
            |:.| .:.:|...::|    ||.:|:....|          .||..| ::|:.:.||..|...|.
 Frog     9 GAAC-CSNQWLAAVILSLCCLLPSCLPAGQS----------MDFQWPAVDNLVVRQGETAMLRCF 62

  Fly   121 VNNLGGHRVSGDGSSAPAKVAWIKADAKAILAIHEHVITNNDRLSVQHNDYNTWTLNIRGVKMED 185
            :.         :|:|   |.||:  :..:|:.......:.:.|:|:..:....::|.|:.|.:.|
 Frog    63 LE---------EGAS---KGAWL--NRSSIIFAGGDKWSVDPRVSIATSSKQEYSLRIQKVDVSD 113

  Fly   186 AGKYMCQVNTD--PMKMQTATLEVVIPPDIINEETSGDMMVPEGGSAKLVCRARGHPKPKITWRR 248
            .|.|.|.|.|:  |..:| ..|.|.:.|.|.  :.|.||.|.||.:..|:|.|.|.|:|.|:|| 
 Frog   114 DGPYTCSVQTEHSPRTLQ-VHLTVHVSPKIY--DISSDMTVNEGTNVSLICLATGKPEPSISWR- 174

  Fly   249 EDGREIIARNGSHQKTKA-QSVEGEMLTLSKITRSEMGAYMCIASNGVPPTVSKRMKLQVHFHPL 312
                        |....| |...|:.|.:..|||.:.|.|.|.|.|.|.....|::|:.|:|   
 Frog   175 ------------HISPSAKQFGSGQYLDIYGITRDQAGDYECSAENDVSFPDVKKVKVTVNF--- 224

  Fly   313 VQVPNQLVGAPVLTDVT-----------LICNVEASPKAINYWQRENGEMIIAGDRYALTEKENN 366
                     ||.:.::|           :.|...|.|..:..|.:  ||..:...:..:..:.  
 Frog   225 ---------APTILEITPTGVSLGRTGLIRCETAAVPAPVFEWYK--GEKKLTNGQRGIRIQN-- 276

  Fly   367 MYAIEMILHIKRLQSSDFGGYKCISKNSIGDTEGTIRLYEMERPGKKILRDDDLNEVSKNEVVQK 431
             |....||.:..:....||.|.|::.|.:|.:..::.|                     |::::.
 Frog   277 -YNTRSILTVSNVTEEHFGNYTCVAVNKLGTSNASLPL---------------------NQIIEP 319

  Fly   432 DTRSE-DGSRNLNGRLYKDRAPDQ-H---PASGSDQLLGRGTMRLIGTFLLALLVLFTAL 486
            .|.|. ..|...:.:.|...:.|: |   |::....:.||..:.....:|:..|..||::
 Frog   320 STTSPVTSSAKYSVKHYARSSSDKPHYAAPSTAQYGITGRAEILFSCWYLVLTLSSFTSI 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 I-set 98..209 CDD:254352 29/113 (26%)
ig 102..195 CDD:278476 22/93 (24%)
IG_like 219..307 CDD:214653 31/88 (35%)
Ig 221..307 CDD:299845 30/86 (35%)
Ig 311..404 CDD:299845 18/103 (17%)
IG_like 327..405 CDD:214653 16/88 (18%)
negr1XP_031755650.1 Ig 44..136 CDD:416386 26/106 (25%)
FR1 44..62 CDD:409353 5/17 (29%)
Ig strand A' 47..53 CDD:409353 1/5 (20%)
Ig strand B 55..63 CDD:409353 2/7 (29%)
CDR1 63..68 CDD:409353 1/13 (8%)
FR2 69..75 CDD:409353 3/7 (43%)
Ig strand C 69..74 CDD:409353 3/6 (50%)
CDR2 76..87 CDD:409353 1/10 (10%)
Ig strand C' 78..82 CDD:409353 1/3 (33%)
Ig strand C' 84..87 CDD:409353 0/2 (0%)
FR3 88..122 CDD:409353 9/33 (27%)
Ig strand D 91..98 CDD:409353 2/6 (33%)
Ig strand E 101..107 CDD:409353 1/5 (20%)
Ig strand F 114..122 CDD:409353 3/7 (43%)
CDR3 123..127 CDD:409353 1/3 (33%)
Ig strand G 127..136 CDD:409353 3/9 (33%)
FR4 129..136 CDD:409353 2/7 (29%)
Ig_3 140..208 CDD:404760 29/82 (35%)
Ig strand A' 146..151 CDD:409353 3/4 (75%)
Ig strand B 157..164 CDD:409353 2/6 (33%)
Ig strand C 170..175 CDD:409353 3/17 (18%)
Ig strand C' 177..179 CDD:409353 0/1 (0%)
Ig strand E 187..193 CDD:409353 1/5 (20%)
Ig strand F 200..207 CDD:409353 3/6 (50%)
Ig strand G 214..222 CDD:409353 2/7 (29%)
Ig_3 226..302 CDD:404760 15/80 (19%)
putative Ig strand A 226..232 CDD:409353 1/5 (20%)
Ig strand B 242..246 CDD:409353 0/3 (0%)
Ig strand C 255..259 CDD:409353 0/3 (0%)
Ig strand E 281..285 CDD:409353 2/3 (67%)
Ig strand F 295..300 CDD:409353 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 58 1.000 Domainoid score I10578
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 138 1.000 Inparanoid score I4412
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.