DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HSPA8 and CG7182

DIOPT Version :9

Sequence 1:NP_006588.1 Gene:HSPA8 / 3312 HGNCID:5241 Length:646 Species:Homo sapiens
Sequence 2:NP_001286979.1 Gene:CG7182 / 38944 FlyBaseID:FBgn0035878 Length:513 Species:Drosophila melanogaster


Alignment Length:523 Identity:136/523 - (26%)
Similarity:236/523 - (45%) Gaps:73/523 - (13%)


- Green bases have known domain annotations that are detailed below.


Human     5 PAVGIDLGTTYSCVG-VFQHGKVEIIANDQGNRTTPSYVAFTDTERL-IGDAAKNQVAMNPTNTV 67
            |..||.:|.:..|:. |...||.|:|||.||:|.:.:.:.:.....: .|..||.::|..|...|
  Fly     3 PRFGIKIGNSTLCIAHVRADGKAEVIANKQGDRVSQACLLWDGASEIECGLTAKQKMANRPRQAV 67

Human    68 ----------------------------FDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQ 104
                                        ||.:.|:.|.  :..|.||.:.....||         
  Fly    68 AHSFQLLQPKEELTEEKLSSALREIPCDFDKEELVFRM--EHTVPSDREDQDDRVV--------- 121

Human   105 VEYKGETKSFYPEEVSSMVLTKMKEIAEAYL--GKTVTNAVVTVPAYFNDSQRQATKDAGTIAGL 167
                  ||.....:|:..:|....|:|..|.  |:....||:::|:|:..|..:...||...||.
  Fly   122 ------TKDLSAYQVTVELLRAELELAHQYHTDGEQAPIAVLSIPSYYPASAYKLLADAAQTAGF 180

Human   168 NVLRIINEPTAAAIAYGL-DKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGE 231
            :|.:||.|||||.:.|.: :::....|:||....||...|::..::::|:|...:|.|...:||.
  Fly   181 HVAQIITEPTAAVLGYSIGEEQTEQRRHVLTIKCGGLYSDIAFYSVQNGLFVQLATFGPFPIGGR 245

Human   232 DFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTS 296
            .|...:|.....||:||:|.|..|::|:|.::|||....|..|::.....:.||||.:|:|:...
  Fly   246 QFTEALVQFICEEFRRKYKLDPHESRRSVAKIRTAAANCKHILTTMPSTQLYIDSLMDGVDYNAQ 310

Human   297 ITRARFEELNADLFRGTLDPVEKALRDAKLDK---SQIHDIVLVGGSTRIPKIQKLLQDFFNGKE 358
            ::|||||.|...:....:..:.:.:..|:.:.   |:|.||||:|.:.:|||:|..:...|...:
  Fly   311 MSRARFESLIQPVINNLIQQLGECVEQAQKEHPGLSKIDDIVLLGATMQIPKLQAAVGARFPDAK 375

Human   359 LNKSINPDEAVAYGAAVQAAILSGDKSENV----------QDLLLLDVTPLSLGIETAGGVMTVL 413
            |:.|.:.||.||.|.|.||..|.....:.:          .||.:..      |.:.:..  .::
  Fly   376 LHNSHSADEVVAIGCARQAVCLIDPLEQQLHKEEDCVVAEDDLFIWH------GNDESNA--KLV 432

Human   414 IKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTF 478
            :.|.:.:|.|...:.....:.:...:.:.....:..|.::.:|.:...:.||  ..|:.|:||..
  Fly   433 LGRGSVLPAKIRISLPQSEEGKGDDVSKAAASFKLRTGESEILARLPDSTIP--EDGLYQLEVEV 495

Human   479 DID 481
            |:|
  Fly   496 DVD 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HSPA8NP_006588.1 PTZ00009 1..613 CDD:240227 136/523 (26%)
Nucleotide-binding domain (NBD). /evidence=ECO:0000305|PubMed:27474739 2..386 120/416 (29%)
Interaction with BAG1 186..377 61/193 (32%)
Substrate-binding domain (SBD). /evidence=ECO:0000305|PubMed:27474739 394..509 14/88 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 614..646
CG7182NP_001286979.1 NBD_sugar-kinase_HSP70_actin 5..394 CDD:302596 116/405 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.