DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hlc and DDX18

DIOPT Version :9

Sequence 1:NP_001285517.1 Gene:Hlc / 33118 FlyBaseID:FBgn0001565 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_006764.3 Gene:DDX18 / 8886 HGNCID:2741 Length:670 Species:Homo sapiens


Alignment Length:492 Identity:129/492 - (26%)
Similarity:220/492 - (44%) Gaps:105/492 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LDQRILKAVAQLGWQQPTLIQSTAIPLLLEGKDVVVRARTGSGKTATYALPLIQKILNSKLNASE 80
            :::..|||:.::|:...|.||..:|..||||:|::..|:||||||..:.:|.::.|:..:. ...
Human   186 VNENTLKAIKEMGFTNMTEIQHKSIRPLLEGRDLLAAAKTGSGKTLAFLIPAVELIVKLRF-MPR 249

  Fly    81 QYVSAVVLAPTKELCRQSRKVIEQL----VESCGKVVRVADIADSSNDTVTQRHALSESPDIVVA 141
            .....::|:||:||..|:..|:::|    |.:.|.:     :..|:.....|:  |....:|:||
Human   250 NGTGVLILSPTRELAMQTFGVLKELMTHHVHTYGLI-----MGGSNRSAEAQK--LGNGINIIVA 307

  Fly   142 TPANLLAYAEAGSVVDLKHVETLVVDEADLVFAYGYEKDFKRLIKHLPPIYQAVLVSATLT---D 203
            ||..||.:.:.......|:::.||:||||.:...|:|::.|::||.||...|.:|.|||.|   :
Human   308 TPGRLLDHMQNTPGFMYKNLQCLVIDEADRILDVGFEEELKQIIKLLPTRRQTMLFSATQTRKVE 372

  Fly   204 DVVRMKGLCLNNPVTLKLEEPELVPQDQ---------LSHQRILAEENDKPAILYALLKLRLIRG 259
            |:.|         ::|| :||..|..|.         |....::.....:..:|:..|| :..:.
Human   373 DLAR---------ISLK-KEPLYV
GVDDDKANATVDGLEQGYVVCPSEKRFLLLFTFLK-KNRKK 426

  Fly   260 KSIIFVNSIDRCYKVRL---FLEQFGIRACVLNSELPANIRIHTISQFNKGTYDIIIASDEHHME 321
            |.::|.:|   |..|:.   .|....:....::.:...|.|..|..||.......::.:|     
Human   427 KLMVFFSS---CMSVKYHYELLNYIDLPVLAIHGKQKQNKRTTTFFQFCNADSGTLLCTD----- 483

  Fly   322 KPGGKSATNRKSPRSGDMESSASRGIDFQCVNNVINFDFPRDVTSYIHRAGRTARG-NNKGSVLS 385
                                .|:||:|...|:.::.:|.|.|...||||.|||||| |.:|..|.
Human   484 --------------------VAARGLDIPEVDWIVQYDPPDDPKEYIHRVGRTARGLNGRGHALL 528

  Fly   386 FVS---------MKESKVN----DSVEKKLCDSFAAQEGEQIIKNYQFKMEEVESFRYR-AQDCW 436
            .:.         :|:|||.    |....|:.| ..:|..:.|.|||         |.:: ||:.:
Human   529 ILRPEELGFLRYLKQSKVPLSEFDFSWSKISD-IQSQLEKLIEKNY---------FLHKSAQEAY 583

  Fly   437 RAATRVAVHDTRIREIKIEILNCEKLKAFFEENKRDL 473
            ::..|  .:|:            ..||..|..|..:|
Human   584 KSYIR--AYDS------------HSLKQIFNVNNLNL 606

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HlcNP_001285517.1 P-loop_NTPase 11..220 CDD:304359 64/210 (30%)
DEXDc 24..231 CDD:214692 66/213 (31%)
HELICc 234..386 CDD:238034 36/155 (23%)
DDX18NP_006764.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 31..169
DEADc 179..386 CDD:238167 68/217 (31%)
Q motif 179..207 6/20 (30%)
DEXDc 194..382 CDD:214692 63/205 (31%)
DEAD box 333..336 2/2 (100%)
HELICc 400..529 CDD:238034 37/157 (24%)
DUF4217 561..619 CDD:290667 15/69 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D973872at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.