DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hlc and AT1G71280

DIOPT Version :9

Sequence 1:NP_001285517.1 Gene:Hlc / 33118 FlyBaseID:FBgn0001565 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_177284.1 Gene:AT1G71280 / 843469 AraportID:AT1G71280 Length:465 Species:Arabidopsis thaliana


Alignment Length:245 Identity:77/245 - (31%)
Similarity:120/245 - (48%) Gaps:21/245 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 QFHELE--LDQRILKAVAQLGWQQPTLIQSTAIPLLLEGKDVVVRARTGSGKTATYALPLIQKIL 72
            :|.||:  |.:.|::|:.:.|::..|.:|:..||.|...|||||.|.||||||..:.||.|:.|.
plant    16 RFSELKPPLSEDIIEALDRSGFEVCTPVQAETIPFLCSHKDVVVDAATGSGKTLAFLLPFIEIIR 80

  Fly    73 NSKLNASEQY-VSAVVLAPTKELCRQSRKVIEQLVESCGKVVRVADIADSSNDTVTQRHALSESP 136
            .|.....:.: |..|:::||:||..|..||        .:.||: |.|..............|..
plant    81 RSNSYPPKPHQVMGVIISPTRELSAQIHKV--------ARAVRL-DFAKCREVEADMNTLEEEGA 136

  Fly   137 DIVVATPANLLAYAEAGSVVDLKHVETLVVDEADLVFAYGYEKDFKRLIKHLPPIYQAVLVSATL 201
            ::::.||..|....:....:|.:::|.|::||||.:...|::|....:|..||...:..|.|||.
plant   137 NLLIGTPGRLSDMMKRMEFLDFRNLEILILDEADRLLDMGFQKQVNYIISRLPKQRRTGLFSATQ 201

  Fly   202 TDDVVRMKGLCLNNPVTLKLEEPELVPQDQLSHQ--RILAEENDKPAILY 249
            |..|..:....|.||. ||.|      .||.|.|  .:|.|..:|..:::
plant   202 TQAVADLAKAGLRNPY-LKCE------ADQKSSQLVHLLIENKNKKLVVF 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HlcNP_001285517.1 P-loop_NTPase 11..220 CDD:304359 67/211 (32%)
DEXDc 24..231 CDD:214692 64/207 (31%)
HELICc 234..386 CDD:238034 4/18 (22%)
AT1G71280NP_177284.1 DEADc 17..217 CDD:238167 66/208 (32%)
DEXDc 32..217 CDD:214692 60/193 (31%)
Helicase_C 223..>314 CDD:278689 7/22 (32%)
DUF4217 314..368 CDD:290667
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D973872at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.