DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hlc and mahe

DIOPT Version :9

Sequence 1:NP_001285517.1 Gene:Hlc / 33118 FlyBaseID:FBgn0001565 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_001284994.1 Gene:mahe / 31707 FlyBaseID:FBgn0029979 Length:945 Species:Drosophila melanogaster


Alignment Length:399 Identity:112/399 - (28%)
Similarity:187/399 - (46%) Gaps:34/399 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SQMTQKTVQFHELELDQRILKAVAQLGWQQPTLIQSTAIPLLLEGKDVVVRARTGSGKTATYALP 66
            :::....|.|.|..|...:::.:.:.|:.:||.|||...|:.|.|:|:|..|:||||||..|.||
  Fly   230 NELPHPVVSFEESSLPAHVIEEMKRQGFTKPTAIQSQGWPIALSGRDLVGIAQTGSGKTLAYMLP 294

  Fly    67 LIQKILNSKLNASEQYVSAVVLAPTKELCRQSRKVIEQLVESCGKVVRVADIADSSNDTVTQRHA 131
            .|..|.|.......:...|:|||||:||.:|.:.|:......|...:|...|...|: .|.|...
  Fly   295 AIVHIGNQPPIIRGEGPIALVLAPTRELAQQIQSVVRDYGHLCKPEIRHTCIFGGSS-KVPQARD 358

  Fly   132 LSESPDIVVATPANLLAYAEAGSVVDLKHVETLVVDEADLVFAYGYEKDFKRLIKHLPPIYQAVL 196
            |....::::|||..|:.:.|..: .:|:....||:||||.:...|:|...:::|:.:.|..|.|:
  Fly   359 LDRGVEVIIATPGRLIDFLENRN-TNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQVVM 422

  Fly   197 VSATLTDDVVRMKGLCLNNPVTLKLEEPELVPQDQLSHQRILAEENDKPAILYALL-KLRLIR-- 258
            .|||...:|..:.|..||:.:.:.:....|.....:.....:..|.:||..|..|| ::..|:  
  Fly   423 WSATWPKEVQALAGDFLNDYIQINIGSMNLSANHNIRQIVEICTEIEKPQRLVCLLNEISPIKNS 487

  Fly   259 ----GKSIIFVNSIDRCYKVRLFLEQFGIRACVLNSELPANIRIHTISQFNKGTYDIIIASDEHH 319
                .|.|:||.:..:...:...:...|..|..::.:...|.|...:..|..|..:|:||:|   
  Fly   488 GNNGNKIIVFVETKIKVEDILQIIRAEGYNATSIHGDKTQNERDSVLKDFRNGKSNILIATD--- 549

  Fly   320 MEKPGGKSATNRKSPRSGDMESSASRGIDFQCVNNVINFDFPRDVTSYIHRAGRTARGNNKGSVL 384
                                  .||||:|.:.:..|||:|:|....:|:||.|||.|....|:..
  Fly   550 ----------------------VASRGLDVEDLQYVINYDYPNSSENYVHRIGRTGRCQQLGTAY 592

  Fly   385 SFVSMKESK 393
            :|.:...:|
  Fly   593 TFFTPDNAK 601

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HlcNP_001285517.1 P-loop_NTPase 11..220 CDD:304359 69/208 (33%)
DEXDc 24..231 CDD:214692 67/206 (33%)
HELICc 234..386 CDD:238034 39/158 (25%)
maheNP_001284994.1 PTZ00110 136..656 CDD:240273 112/399 (28%)
DEADc 239..446 CDD:238167 69/208 (33%)
HELICc 457..594 CDD:238034 39/161 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451752
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.