DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hlc and Ddx55

DIOPT Version :9

Sequence 1:NP_001285517.1 Gene:Hlc / 33118 FlyBaseID:FBgn0001565 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_001258255.1 Gene:Ddx55 / 100362764 RGDID:2324094 Length:600 Species:Rattus norvegicus


Alignment Length:418 Identity:107/418 - (25%)
Similarity:193/418 - (46%) Gaps:60/418 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSQMTQKTVQFHELELDQRILKAVAQLGWQQPTLIQSTAIPLLLEGKDVVVRARTGSGKTATYAL 65
            |..:|:.:.:..::.|...:|.|:.:||:...|.:||..|||.:..|||...|.||||||..:.:
  Rat     1 MEHVTEGSWESLQVPLHPLVLGALRELGFLHMTPVQSATIPLFMRNKDVAAEAVTGSGKTLAFVI 65

  Fly    66 PLIQKILNSKLNASEQYVSAVVLAPTKELCRQSRKVIEQLVESCGKVVRVADIADSSNDTVTQRH 130
            |:::.:|..:....:..|.|:|:.||:||..|..:|:....:...:..::..|...:.....:|.
  Rat    66 PILEILLRREEKLKKNQVGAIVITPTRELAIQIDEVLSHFTKHFPQFSQILWIGGRNPGEDVERF 130

  Fly   131 ALSESPDIVVATPANLL-AYAEAGSVVDL----KHVETLVVDEADLVFAYGYEKDFKRLIKHLPP 190
            . ....:|:||||..|. .:......:||    |.::.||:||||.:...|:|.....:::.||.
  Rat   131 K-QHGGNIIVATPGRLEDMFRRKAEGLDLASYVKSLDVLVLDEADRLLDMGFEASINTILEFLPK 194

  Fly   191 IYQAVLVSATLTDDVVRMKGLCLNNPVTLKLEEPELVPQ------DQLSHQRILAEENDKPAILY 249
            ..:..|.|||.|.:|..:....|.|||.:.::|..:...      .:|.:..::.:.::|...|.
  Rat   195 QRRTGLFSATQTQEVENLVRAGLRNPVRISVKEKGVAASSTQKTPSRLENHYMICKADEKFNQLV 259

  Fly   250 ALLKLRLIRGKSIIFVNSIDRCYKVRLFLEQFG--IRACVLNSELPANIRIH---------TISQ 303
            ..|:.|. :.|.::|.::. .|      :|.:|  :.|.|...::   :.||         ...:
  Rat   260 HFLRSRQ-QEKHLVFFSTC-AC------VEYYGKALEALVQRVKI---LCIHGKMKYKRNKIFME 313

  Fly   304 FNKGTYDIIIASDEHHMEKPGGKSATNRKSPRSGDMESSASRGIDFQCVNNVINFDFPRDVTSYI 368
            |.|....|::.:|                         ..:||||...||.|:.:|.|.:.::::
  Rat   314 FRKLQSGILVCTD-------------------------VMARGIDIPEVNWVLQYDPPSNASAFV 353

  Fly   369 HRAGRTARGNNKGSVLSF-VSMKESKVN 395
            ||.|||||..:.||.|.| :.|:|:.:|
  Rat   354 HRCGRTARIGHGGSALVFLLPMEEAYIN 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HlcNP_001285517.1 P-loop_NTPase 11..220 CDD:304359 63/213 (30%)
DEXDc 24..231 CDD:214692 61/217 (28%)
HELICc 234..386 CDD:238034 36/162 (22%)
Ddx55NP_001258255.1 DEADc 9..224 CDD:238167 63/215 (29%)
DEXDc 24..228 CDD:214692 60/204 (29%)
Helicase_C 252..363 CDD:278689 33/146 (23%)
DUF4217 403..462 CDD:290667
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D973872at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.