DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sep1 and TOC132

DIOPT Version :9

Sequence 1:NP_523430.1 Gene:Sep1 / 33114 FlyBaseID:FBgn0011710 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_001324729.1 Gene:TOC132 / 816165 AraportID:AT2G16640 Length:1206 Species:Arabidopsis thaliana


Alignment Length:449 Identity:84/449 - (18%)
Similarity:141/449 - (31%) Gaps:213/449 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 FEFTLMVVGESGLGKSTLVNSL-----FLTDLYPERIIPDAIEKQKQTVKLEASTVEIEERGVKL 93
            |..|:||:|:||:|||..:||:     |.||.:           |..|.:::  .||...:|:|:
plant   573 FSCTIMVLGKSGVGKSATINSIFDEVKFCTDAF-----------QMGTKRVQ--DVEGLVQGIKV 624

  Fly    94 RLTVVDTPG----FGDAIDNS---NSFGAILE--------YID---------------------- 121
            |  |:||||    :.|...|.   ||..|.::        |:|                      
plant   625 R--VIDTPGLLPSWSDQAKNEKILNSVKAFIKKNPPDIVLYLDRLDMQSRDSGDMPLLRTISDVF 687

  Fly   122 ---------------------------EQYERF-----------LRDESG----LNRRNIVDNRI 144
                                       ..|:.|           :|..:|    :|..::|:|..
plant   688 GPSIWFNAIVGLTHAASVPPDGPNGTASSYDMFVTQRSHVIQQAIRQAAGDMRLMNPVSLVENHS 752

  Fly   145 HC----CFYFISPFGHGLKP--LDVEFMKKLHSKVNIVPVIAKADCLTKKE--------ILRLKC 195
            .|    ....:.|.|...||  |.:.|..|         ::|:|:.|.|.:        ..|.|.
plant   753 ACRTNRAGQRVLPNGQVWKPHLLLLSFASK---------ILAEANALLKLQDNIPGRPFAARSKA 808

  Fly   196 RIMQEIESHGIKIYPLP------------------DCDSDEDEDY------------------KE 224
            ..:..:.|..::..|.|                  ..||||:.:|                  |.
plant   809 PPLPFLLSSLLQSRPQPKLPEQQYGDEEDEDDLEESSDSDEESEYDQLPPFKSLTKAQMATLSKS 873

  Fly   225 QVKQLKEAVPFAVCGANTLL---EVKGKKVRGRLYPWGVVEV----------------------- 263
            |.||..:.:.:    ...||   ::|.::.|.:::.....|:                       
plant   874 QKKQYLDEMEY----REKLLMKKQMKEERKRRKMFKKFAAEIKDLPDGYSENVEEESGGPASVPV 934

  Fly   264 -------------ENPDH-------CDFIKLRTMLITHMQDLQEVTQEVHYENYRSDRL 302
                         :||.|       .:...:|.:|.||..|     .::.||...::||
plant   935 PMPDLSLPASFDSDNPTHRYRYLDSSNQWLVRPVLETHGWD-----HDIGYEGVNAERL 988

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sep1NP_523430.1 CDC3 13..342 CDD:227352 84/449 (19%)
Septin 32..304 CDD:279124 84/449 (19%)
TOC132NP_001324729.1 3a0901s04IAP86 454..1206 CDD:273381 84/449 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D845354at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.