DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sep1 and septin9

DIOPT Version :9

Sequence 1:NP_523430.1 Gene:Sep1 / 33114 FlyBaseID:FBgn0011710 Length:361 Species:Drosophila melanogaster
Sequence 2:XP_002935968.2 Gene:septin9 / 733881 XenbaseID:XB-GENE-1012202 Length:576 Species:Xenopus tropicalis


Alignment Length:311 Identity:144/311 - (46%)
Similarity:219/311 - (70%) Gaps:8/311 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 GYVGFANLPNQVHRKSVKKGFEFTLMVVGESGLGKSTLVNSLFLTDLYPERIIPDAIEKQKQTVK 78
            ||||...:..|:.:|::|:|||..:||||:||||||||:|:||.:.:..:.:.|.|.|:..:|::
 Frog   268 GYVGIDAILEQMRKKAMKQGFELNIMVVGQSGLGKSTLINTLFKSKVSRKSVQPTAEERIPKTIE 332

  Fly    79 LEASTVEIEERGVKLRLTVVDTPGFGDAIDNSNSFGAILEYIDEQYERFLRDESGLNR-RNIVDN 142
            :::.|.||||:||:::|||:|||||||.|:|.|.:..|:::|::|||::|::|..:|| :.|.|:
 Frog   333 IKSVTHEIEEKGVRMKLTVIDTPGFGDHINNENCWLPIMKFINDQYEKYLQEEVNINRKKRIPDS 397

  Fly   143 RIHCCFYFISPFGHGLKPLDVEFMKKLHSKVNIVPVIAKADCLTKKEILRLKCRIMQEIESHGIK 207
            |:|||.|||...||.|:|||:|||::|...|||||||||||.||.:|....|.||..:::::||.
 Frog   398 RVHCCIYFIPATGHSLRPLDIEFMRRLSKVVNIVPVIAKADTLTLEERDYFKQRIRADLQNNGID 462

  Fly   208 IYPLPDCDSD-EDEDYKEQVKQLKEAVPFAVCGANTLLEVKGKKVRGRLYPWGVVEVENPDHCDF 271
            |||..:.|.| ||....|::   :|.:||||.|::...::.|:::.||...||.:||||..||:|
 Frog   463 IYPQKEFDEDAEDRLVNEKI---REMIPFAVVGSDQEYQINGRRILGRKTKWGTIEVENTGHCEF 524

  Fly   272 IKLRTMLI-THMQDLQEVTQEVHYENYRSDRLAKGIKGKENGVKAERDSSS 321
            ..||.:|| ||||:::::|..:|:|.||..||.:| ....||. .|:|.||
 Frog   525 ACLRDLLIRTHMQNIKDITSSIHFEAYRVKRLQEG-NMMSNGT-TEKDYSS 573

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sep1NP_523430.1 CDC3 13..342 CDD:227352 144/311 (46%)
Septin 32..304 CDD:279124 130/274 (47%)
septin9XP_002935968.2 CDC_Septin 286..560 CDD:206649 131/277 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D452703at33208
OrthoFinder 1 1.000 - - FOG0000103
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.