DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sep1 and Septin11

DIOPT Version :9

Sequence 1:NP_523430.1 Gene:Sep1 / 33114 FlyBaseID:FBgn0011710 Length:361 Species:Drosophila melanogaster
Sequence 2:XP_006535161.1 Gene:Septin11 / 52398 MGIID:1277214 Length:441 Species:Mus musculus


Alignment Length:350 Identity:151/350 - (43%)
Similarity:218/350 - (62%) Gaps:32/350 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SIETPGYVGFANLPNQVHRKSVKKGFEFTLMVVGESGLGKSTLVNSLFLTDLYPERIIPDAIEKQ 73
            ::...|:|||.:||:|:..||..:||.|.::.|||:|:|||||:::||.|     :...|.....
Mouse    24 NLSLSGHVGFDSLPDQLVNKSTSQGFCFNILCVGETGIGKSTLMDTLFNT-----KFESDPATHN 83

  Fly    74 KQTVKLEASTVEIEERGVKLRLTVVDTPGFGDAIDNSNSFGAILEYIDEQYERFLRDESGLNRR- 137
            :..|:|:|.:.|::|..|:|:||:|||.||||.|:..:|:..|:||||.|:|.:|::|..:.|. 
Mouse    84 EPGVRLKARSYELQESNVRLKLTIVDTVGFGDQINKDDSYKPIVEYIDAQFEAYLQEELKIKRSL 148

  Fly   138 -NIVDNRIHCCFYFISPFGHGLKPLDVEFMKKLHSKVNIVPVIAKADCLTKKEILRLKCRIMQEI 201
             |..|.|||.|.|||:|.||.||.||:..||||.|||||:|:|||||.:.|.|:.:.|.:||.|:
Mouse   149 FNYHDTRIHACLYFIAPTGHSLKSLDLVTMKKLDSKVNIIPIIAKADTIAKNELHKFKSKIMSEL 213

  Fly   202 ESHGIKIYPLPDCDSDEDEDYKEQVKQLKEAVPFAVCGANTLLEVKGKKVRGRLYPWGVVEVENP 266
            .|:|::||..|    .::|...|....:...:||||.|:...:::..|..:.|.||||||:|||.
Mouse   214 VSNGVQIYQFP----TDEETVAEINATMSVHLPFAVVGSTEEVKIGNKMAKARQYPWGVVQVENE 274

  Fly   267 DHCDFIKLRTMLI-THMQDLQEVTQEVHYENYRSDRLAKGIKGKENGVKAERDSSSQVVS----- 325
            :||||:|||.||| .:|:||:|.|...|||.||..:|      :|.|.| :.|..|:..|     
Mouse   275 NHCDFVKLREMLIRVNMEDLREQTHTRHYELYRRCKL------EEMGFK-DTDPDSKPFSLQETY 332

  Fly   326 ----NSVLGEKDRILQEKEAELRRM 346
                |..|||    ||:||.|:|:|
Mouse   333 EAKRNEFLGE----LQKKEEEMRQM 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sep1NP_523430.1 CDC3 13..342 CDD:227352 148/340 (44%)
Septin 32..304 CDD:279124 125/274 (46%)
Septin11XP_006535161.1 CDC_Septin 47..315 CDD:206649 126/282 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838866
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5019
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D845354at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2060
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.780

Return to query results.
Submit another query.