DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sep1 and Sep2

DIOPT Version :9

Sequence 1:NP_523430.1 Gene:Sep1 / 33114 FlyBaseID:FBgn0011710 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_524417.1 Gene:Sep2 / 42438 FlyBaseID:FBgn0014029 Length:419 Species:Drosophila melanogaster


Alignment Length:346 Identity:153/346 - (44%)
Similarity:222/346 - (64%) Gaps:24/346 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SIETPGYVGFANLPNQVHRKSVKKGFEFTLMVVGESGLGKSTLVNSLFLTDLYPERIIPDAIEKQ 73
            :::..|:|||.:||:|:..|||:.||.|.:|.:||:|||||||:::||.|. :.....|..:   
  Fly    17 TLKQSGHVGFDSLPDQLVNKSVQNGFVFNVMCIGETGLGKSTLMDTLFNTS-FESTPSPHTL--- 77

  Fly    74 KQTVKLEASTVEIEERGVKLRLTVVDTPGFGDAIDNSNSFGAILEYIDEQYERFLRDESGLNRRN 138
             .:|||:|.|.|::|..|:|:||:.||.|:||.|:..:||.|:::|||.|:|.:|::|..:.|..
  Fly    78 -PSVKLKAHTYELQESNVRLKLTICDTVGYGDQINKDDSFKAVVDYIDAQFENYLQEELKIKRSL 141

  Fly   139 IV--DNRIHCCFYFISPFGHGLKPLDVEFMKKLHSKVNIVPVIAKADCLTKKEILRLKCRIMQEI 201
            :.  |:|||.|.|||.|.|||||.||:..||||.|||||:|||||||.::|.|:.|.|.:|:||:
  Fly   142 VTCHDSRIHICLYFICPTGHGLKSLDLVCMKKLDSKVNIIPVIAKADTISKVELQRFKAKIIQEL 206

  Fly   202 ESHGIKIYPLPDCDSDEDEDYKEQVKQLKEAVPFAVCGANTLLEVKGKKVRGRLYPWGVVEVENP 266
            .::|:.||..|    .:||...|....:...:||||.|:...::|..|.:|.|.||||.|:|||.
  Fly   207 NANGVHIYQFP----TDDETVAETNTSMNSHIPFAVVGSTEFIKVGNKLIRARQYPWGTVQVENE 267

  Fly   267 DHCDFIKLRTMLI-THMQDLQEVTQEVHYENYRSDRLAKGIKGKENGVKAERDSSSQVVSNSVLG 330
            .||||:|||.||| |:|:|::|.|...|||.||..||      ::.|. ::.||.::.:|.....
  Fly   268 THCDFVKLREMLIRTNMEDMREKTHTRHYELYRQKRL------EQMGF-SDVDSDNKPISFQQTF 325

  Fly   331 EKDRI-----LQEKEAELRRM 346
            |..|.     ||.||.|:|:|
  Fly   326 EAKRSNHLAELQSKEEEVRQM 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sep1NP_523430.1 CDC3 13..342 CDD:227352 150/336 (45%)
Septin 32..304 CDD:279124 130/274 (47%)
Sep2NP_524417.1 CDC_Septin 40..308 CDD:206649 130/282 (46%)
PTZ00121 <285..393 CDD:173412 23/69 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452042
Domainoid 1 1.000 233 1.000 Domainoid score I490
eggNOG 1 0.900 - - E1_COG5019
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D107010at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18884
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2060
SonicParanoid 00.000 Not matched by this tool.
76.880

Return to query results.
Submit another query.