DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sep1 and pnut

DIOPT Version :9

Sequence 1:NP_523430.1 Gene:Sep1 / 33114 FlyBaseID:FBgn0011710 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_477064.1 Gene:pnut / 35801 FlyBaseID:FBgn0013726 Length:539 Species:Drosophila melanogaster


Alignment Length:350 Identity:187/350 - (53%)
Similarity:242/350 - (69%) Gaps:18/350 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IETPGYVGFANLPNQVHRKSVKKGFEFTLMVVGESGLGKSTLVNSLFLTDLYPERIIPDAIEKQK 74
            :|..||||||||||||:||:||:||||||||||.||||||||:||:||:|:|.....|....::|
  Fly   117 MEIAGYVGFANLPNQVYRKAVKRGFEFTLMVVGASGLGKSTLINSMFLSDIYNAEQYPGPSLRKK 181

  Fly    75 QTVKLEASTVEIEERGVKLRLTVVDTPGFGDAIDNSNSFGAILEYIDEQYERFLRDESGLNRRNI 139
            :||.:||:.|.::|.||.|.||||||||||||:||||.:..||||:|.:||.:|..||.:.|:.|
  Fly   182 KTVAVEATKVMLKENGVNLTLTVVDTPGFGDAVDNSNCWVPILEYVDSKYEEYLTAESRVYRKTI 246

  Fly   140 VDNRIHCCFYFISPFGHGLKPLDVEFMKKLHSKVNIVPVIAKADCLTKKEILRLKCRIMQEIESH 204
            .|:|:|||.|||:|.||||.|||:..|:.|..|||:||||||||.:|..|:...|.:|:.||..|
  Fly   247 SDSRVHCCLYFIAPSGHGLLPLDIACMQSLSDKVNLVPVIAKADTMTPDEVHLFKKQILNEIAQH 311

  Fly   205 GIKIYPLPDCDSDEDEDYKEQVKQLKEAVPFAVCGANTLLEVKGKKVRGRLYPWGVVEVENPDHC 269
            .||||..|....|..|:.| ..:.|:..|||||.||||::|..|||||||.||||:|||||..||
  Fly   312 KIKIYDFPATLEDAAEEAK-TTQNLRSRVPFAVVGANTIIEQDGKKVRGRRYPWGLVEVENLTHC 375

  Fly   270 DFIKLRTMLI-THMQDLQEVTQEVHYENYRSDRLAKGIKGKENGVKAERDSSSQVVSNSVLGEKD 333
            |||.||.|:| ||:|||::||..|||||||..:|:      |.|:         |...:.|..|:
  Fly   376 DFIALRNMVIRTHLQDLKDVTNNVHYENYRCRKLS------ELGL---------VDGKARLSNKN 425

  Fly   334 RILQEKEAELRRMQEMLAQMQARMQ 358
            .:.|.:| |.|..::.:.:|:|.|:
  Fly   426 PLTQMEE-EKREHEQKMKKMEAEME 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sep1NP_523430.1 CDC3 13..342 CDD:227352 181/329 (55%)
Septin 32..304 CDD:279124 158/272 (58%)
pnutNP_477064.1 CDC3 121..482 CDD:227352 186/345 (54%)
Septin 139..411 CDD:279124 158/278 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452041
Domainoid 1 1.000 294 1.000 Domainoid score I811
eggNOG 1 0.900 - - E1_COG5019
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D107010at6656
OrthoFinder 1 1.000 - - FOG0000103
OrthoInspector 1 1.000 - - otm14281
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18884
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2060
SonicParanoid 1 1.000 - - X204
109.880

Return to query results.
Submit another query.