DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sep1 and Septin3

DIOPT Version :9

Sequence 1:NP_523430.1 Gene:Sep1 / 33114 FlyBaseID:FBgn0011710 Length:361 Species:Drosophila melanogaster
Sequence 2:XP_030104428.1 Gene:Septin3 / 24050 MGIID:1345148 Length:826 Species:Mus musculus


Alignment Length:302 Identity:149/302 - (49%)
Similarity:212/302 - (70%) Gaps:11/302 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 GYVGFANLPNQVHRKSVKKGFEFTLMVVGESGLGKSTLVNSLFLTDLYPERIIPDAIEKQKQTVK 78
            ||:|...:..|:.:|::|.||:|.:||||:||||||||||:||.:.:..:....:..||..:||:
Mouse   508 GYIGIDTIIEQMRKKTMKTGFDFNIMVVGQSGLGKSTLVNTLFKSQVSRKASSWNREEKIPKTVE 572

  Fly    79 LEASTVEIEERGVKLRLTVVDTPGFGDAIDNSNSFGAILEYIDEQYERFLRDESGLNR-RNIVDN 142
            ::|....|||.|||::|||:|||||||.|:|.|.:..|.:||:||||:||::|..:.| :.|.|.
Mouse   573 IKAIGHVIEEGGVKMKLTVIDTPGFGDQINNENCWEPIEKYINEQYEKFLKEEVNIARKKRIPDT 637

  Fly   143 RIHCCFYFISPFGHGLKPLDVEFMKKLHSKVNIVPVIAKADCLTKKEILRLKCRIMQEIESHGIK 207
            |:|||.|||||.||.|:|||:||||.|...|||:|||||||.:|.:|....|.|:.:|:|.:||:
Mouse   638 RVHCCLYFISPTGHSLRPLDLEFMKHLSKVVNIIPVIAKADTMTLEEKSEFKQRVRKELEVNGIE 702

  Fly   208 IYPLPDCDSD-EDEDYKEQVKQLKEAVPFAVCGANTLLEVKGKKVRGRLYPWGVVEVENPDHCDF 271
            .||..:.|.| ||:...::::|  |::||||.|::...:|.||:|.||..|||::||||.:||:|
Mouse   703 FYPQKEFDEDLEDKTENDKIRQ--ESMPFAVVGSDKEYQVNGKRVLGRKTPWGIIEVENLNHCEF 765

  Fly   272 IKLRTMLI-THMQDLQEVTQEVHYENYRSDRLAKGIKGKENG 312
            ..||..:| ||:|||:|||..:|||.||:.||      .:||
Mouse   766 ALLRDFVIRTHLQDLKEVTHNIHYETYRAKRL------NDNG 801

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sep1NP_523430.1 CDC3 13..342 CDD:227352 149/302 (49%)
Septin 32..304 CDD:279124 141/274 (51%)
Septin3XP_030104428.1 CDC_Septin 527..801 CDD:206649 141/281 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D452703at33208
OrthoFinder 1 1.000 - - FOG0000103
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2060
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.