DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Septin1 and Septin8

DIOPT Version :10

Sequence 1:NP_523430.1 Gene:Septin1 / 33114 FlyBaseID:FBgn0011710 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_001334425.1 Gene:Septin8 / 20362 MGIID:894310 Length:484 Species:Mus musculus


Alignment Length:40 Identity:11/40 - (27%)
Similarity:16/40 - (40%) Gaps:5/40 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 TSQL-----LENSTESFRCTGDDLCYYTSKFQYLTIRFKT 126
            :|||     :....:||.||.....:|.|......:|..|
Mouse   233 SSQLNQHMRIHTGEKSFTCTQCGKSFYCSSHLNQHMRIHT 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Septin1NP_523430.1 Septin 33..304 CDD:395596 11/40 (28%)
Septin8NP_001334425.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23
CDC_Septin 41..309 CDD:206649 11/40 (28%)
G1 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01056 51..58
G3 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01056 103..106
G4 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01056 186..189
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 409..429
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.