DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sep1 and Septin4

DIOPT Version :9

Sequence 1:NP_523430.1 Gene:Sep1 / 33114 FlyBaseID:FBgn0011710 Length:361 Species:Drosophila melanogaster
Sequence 2:XP_006532556.1 Gene:Septin4 / 18952 MGIID:1270156 Length:971 Species:Mus musculus


Alignment Length:359 Identity:221/359 - (61%)
Similarity:283/359 - (78%) Gaps:8/359 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SSIETPGYVGFANLPNQVHRKSVKKGFEFTLMVVGESGLGKSTLVNSLFLTDLYPERIIPDAIEK 72
            ||.:...|||||.||||||||||||||:|||||.||||||||||||||||||||.:|.:..|.|:
Mouse   610 SSEDDKEYVGFATLPNQVHRKSVKKGFDFTLMVAGESGLGKSTLVNSLFLTDLYRDRKLLGAEER 674

  Fly    73 QKQTVKLEASTVEIEERGVKLRLTVVDTPGFGDAIDNSNSFGAILEYIDEQYERFLRDESGLNRR 137
            ..|||::....|:|||:||:||||:|||||||||::|:..:..:.||||:|:|::.||||||||:
Mouse   675 IMQTVEITKHAVDIEEKGVRLRLTIVDTPGFGDAVNNTECWKPVAEYIDQQFEQYFRDESGLNRK 739

  Fly   138 NIVDNRIHCCFYFISPFGHGLKPLDVEFMKKLHSKVNIVPVIAKADCLTKKEILRLKCRIMQEIE 202
            ||.|||:|||.||||||||||:||||||||.||.:|||||::||||.||..|:.|.||:|.:|||
Mouse   740 NIQDNRVHCCLYFISPFGHGLRPLDVEFMKALHQRVNIVPILAKADTLTPPEVDRKKCKIREEIE 804

  Fly   203 SHGIKIYPLPDCDSDEDEDYKEQVKQLKEAVPFAVCGANTLLEVKGKKVRGRLYPWGVVEVENPD 267
            ..|||||..||||||||||:|.|.:.|||::||||.|:||::|.:|::|||||||||:||||||.
Mouse   805 HFGIKIYQFPDCDSDEDEDFKLQDQALKESIPFAVIGSNTVVEARGRRVRGRLYPWGIVEVENPG 869

  Fly   268 HCDFIKLRTMLI-THMQDLQEVTQEVHYENYRS---DRLAKGIKGKENGVKAERDSSSQ----VV 324
            ||||:||||||: ||||||::||:|.||||||:   ..:.:.:..:.|..|..|:|.:.    .|
Mouse   870 HCDFVKLRTMLVRTHMQDLKDVTRETHYENYRAQCIQSMTRLVVKERNRNKLTRESGTDFPIPAV 934

  Fly   325 SNSVLGEKDRILQEKEAELRRMQEMLAQMQARMQ 358
            ......|.:::::||:.|||||||||.::|.:|:
Mouse   935 PPGTDPETEKLIREKDEELRRMQEMLHKIQRQMK 968

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sep1NP_523430.1 CDC3 13..342 CDD:227352 208/336 (62%)
Septin 32..304 CDD:279124 184/275 (67%)
Septin4XP_006532556.1 DUF4655 14..509 CDD:373934
Septin 634..914 CDD:366275 184/279 (66%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5019
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG51878
OrthoDB 1 1.010 - - D452703at33208
OrthoFinder 1 1.000 - - FOG0000103
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2060
SonicParanoid 1 1.000 - - X204
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.