DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sep1 and septin4

DIOPT Version :9

Sequence 1:NP_523430.1 Gene:Sep1 / 33114 FlyBaseID:FBgn0011710 Length:361 Species:Drosophila melanogaster
Sequence 2:XP_002933653.2 Gene:septin4 / 100485625 XenbaseID:XB-GENE-983580 Length:634 Species:Xenopus tropicalis


Alignment Length:355 Identity:206/355 - (58%)
Similarity:273/355 - (76%) Gaps:8/355 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 YVGFANLPNQVHRKSVKKGFEFTLMVVGESGLGKSTLVNSLFLTDLYPERIIPDAIEKQKQTVKL 79
            |||||.||||:|||.|||||||||||.||||||||||:|||||||||.:|.|....|:..|||::
 Frog   280 YVGFATLPNQMHRKYVKKGFEFTLMVAGESGLGKSTLINSLFLTDLYRDRHILSPEERVTQTVEI 344

  Fly    80 EASTVEIEERGVKLRLTVVDTPGFGDAIDNSNSFGAILEYIDEQYERFLRDESGLNRRNIVDNRI 144
            ...||:|:|:||:||||||||||:||||:|...:..:.:|||:|:|::.||||||||||:.|.|:
 Frog   345 VKQTVDIQEKGVRLRLTVVDTPGYGDAINNEICWKPVADYIDQQFEQYFRDESGLNRRNLQDTRV 409

  Fly   145 HCCFYFISPFGHGLKPLDVEFMKKLHSKVNIVPVIAKADCLTKKEILRLKCRIMQEIESHGIKIY 209
            |||.||:||.|||::|:|:||::.|..||||||::.|||.||..|:.:.|.||..||:.:||:||
 Frog   410 HCCLYFLSPLGHGMRPMDIEFLQALQDKVNIVPILGKADSLTPTELQQKKQRIRDEIDKYGIRIY 474

  Fly   210 PLPDCDSDEDEDYKEQVKQLKEAVPFAVCGANTLLEVKGKKVRGRLYPWGVVEVENPDHCDFIKL 274
            ..|:||.|||||:|:|..:||:::||||.|:||::||.|::||||:||||||||||.:|||||||
 Frog   475 QFPECDPDEDEDFKQQDIELKKSIPFAVIGSNTIIEVNGRRVRGRMYPWGVVEVENEEHCDFIKL 539

  Fly   275 RTMLI-THMQDLQEVTQEVHYENYRS---DRLAKGIKGKENGVKAERDSSSQVVSNSVLGEKD-- 333
            ||||| ||||||::||:|.||||||:   ..|.:.:..:.|..|..|:|.:.....|:....|  
 Frog   540 RTMLIRTHMQDLKDVTRETHYENYRAQCIQNLTQRVVRERNRNKLTRESGTDFPIPSMPPSPDHE 604

  Fly   334 --RILQEKEAELRRMQEMLAQMQARMQAQQ 361
              |:::||:.|||||.|:|.:||.:|:..|
 Frog   605 TQRLIREKDEELRRMHEVLQKMQRQMKDSQ 634

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sep1NP_523430.1 CDC3 13..342 CDD:227352 195/334 (58%)
Septin 32..304 CDD:279124 172/275 (63%)
septin4XP_002933653.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D452703at33208
OrthoFinder 1 1.000 - - FOG0000103
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X204
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.