DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sep1 and septin7

DIOPT Version :9

Sequence 1:NP_523430.1 Gene:Sep1 / 33114 FlyBaseID:FBgn0011710 Length:361 Species:Drosophila melanogaster
Sequence 2:XP_031759376.1 Gene:septin7 / 100216295 XenbaseID:XB-GENE-957464 Length:434 Species:Xenopus tropicalis


Alignment Length:380 Identity:205/380 - (53%)
Similarity:266/380 - (70%) Gaps:41/380 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 GYVGFANLPNQVHRKSVKKGFEFTLMVVGESGLGKSTLVNSLFLTDLY-PERIIPDAIEKQKQTV 77
            ||||||||||||:|||||:|||||||||||||||||||:||||||||| |:  .|....:.|:||
 Frog    19 GYVGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYAPD--YPGPSHRIKKTV 81

  Fly    78 KLEASTVEIEERGVKLRLTVVDTPGFGDAIDNSNSFGAILEYIDEQYERFLRDESGLNRRNIVDN 142
            ::|.|.|.|:|.||:|.||:|||||||||:||||.:..:::|||.::|.:|..||.:|||.:.||
 Frog    82 QVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDYIDSKFEDYLNAESRVNRRQMPDN 146

  Fly   143 RIHCCFYFISPFGHGLKPLDVEFMKKLHSKVNIVPVIAKADCLTKKEILRLKCRIMQEIESHGIK 207
            |:|||.|||:|.||||||||:||||:||.||||:|:|||||.||.:|..:.|.:||:||:.|.||
 Frog   147 RVHCCLYFIAPSGHGLKPLDIEFMKRLHEKVNIIPLIAKADTLTPEECQQFKKQIMKEIQEHKIK 211

  Fly   208 IYPLPDCDSDEDEDYKEQVKQLKEAVPFAVCGANTLLEVKGKKVRGRLYPWGVVEVENPDHCDFI 272
            ||..|:.|   ||:..:.||::|:.:|.||.|:||::||.||:||||.|||||.||||.:||||.
 Frog   212 IYEFPETD---DEEENKLVKKIKDGLPLAVVGSNTIIEVNGKRVRGRQYPWGVAEVENGEHCDFT 273

  Fly   273 KLRTMLI-THMQDLQEVTQEVHYENYRSDRLA----KGIKGKEN-----------------GVKA 315
            .||.||| ||||||::||..||||||||.:||    .|:...:|                 .::.
 Frog   274 ILRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYNGVDNNKNKGQLTKYDTVEGMSPLAQMEE 338

  Fly   316 ER----------DSSSQVVSNSVLGEKDRILQEKEAELRRMQEMLAQMQARMQAQ 360
            ||          :...:.|....:.||.:.|::.||||:|..|   ||:..::||
 Frog   339 ERREHVAKMKKMEMEMEQVFEMKVKEKVQKLKDSEAELQRRHE---QMKKNLEAQ 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sep1NP_523430.1 CDC3 13..342 CDD:227352 196/360 (54%)
Septin 32..304 CDD:279124 170/277 (61%)
septin7XP_031759376.1 CDC_Septin 37..307 CDD:206649 170/274 (62%)
DUF5401 <334..>426 CDD:375164 16/60 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D452703at33208
OrthoFinder 1 1.000 - - FOG0000103
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X204
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.