DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dod and AT1G26550

DIOPT Version :9

Sequence 1:NP_523428.1 Gene:dod / 33111 FlyBaseID:FBgn0015379 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_564250.1 Gene:AT1G26550 / 839195 AraportID:AT1G26550 Length:142 Species:Arabidopsis thaliana


Alignment Length:139 Identity:42/139 - (30%)
Similarity:59/139 - (42%) Gaps:33/139 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 DQPTEPAKKAGGGSAGGGDAPDEVHCLHLLVKHKGSRRPSSWREANITRTKEEAQLLLEVYR--- 96
            :.|::...|||..:.|.|.. ..|...|:|.:.:|.                    :.|.|:   
plant    21 EAPSKGKGKAGKAADGLGTC-TYVKARHVLCEKQGK--------------------INEAYKKLQ 64

  Fly    97 -------NKIVQQEATFDELARSYSDCSSAKRGGDLGKFGRGQMQAAFEDAAFKLNVNQLSGIVD 154
                   :|:  ..|.|.::|..||:|.|.|:|||||.|.||:|...|:|.||...|...|....
plant    65 DGWLSNGDKV--PPAEFAKIAAEYSECPSGKKGGDLGWFPRGKMAGPFQDVAFNTPVGVTSAPFK 127

  Fly   155 SDSGLHIIL 163
            |..|.||||
plant   128 STHGYHIIL 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dodNP_523428.1 WW 7..39 CDD:197736 1/3 (33%)
PTZ00356 55..166 CDD:185573 36/119 (30%)
AT1G26550NP_564250.1 Rotamase 55..135 CDD:395514 29/101 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0760
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.