DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dod and PIN1AT

DIOPT Version :9

Sequence 1:NP_523428.1 Gene:dod / 33111 FlyBaseID:FBgn0015379 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_179395.1 Gene:PIN1AT / 816316 AraportID:AT2G18040 Length:119 Species:Arabidopsis thaliana


Alignment Length:115 Identity:61/115 - (53%)
Similarity:79/115 - (68%) Gaps:4/115 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 DEVHCLHLLVKHKGSRRPSSWREAN----ITRTKEEAQLLLEVYRNKIVQQEATFDELARSYSDC 116
            |:|...|:|:||:||||.:||::..    :|.|:|.|...|:..|..||..:|.|:|:|...|||
plant     5 DQVKASHILIKHQGSRRKASWKDPEGKIILTTTREAAVEQLKSIREDIVSGKANFEEVATRVSDC 69

  Fly   117 SSAKRGGDLGKFGRGQMQAAFEDAAFKLNVNQLSGIVDSDSGLHIILRKA 166
            ||||||||||.|||||||..||:|.:.|.|..:|.|||:|||:|||.|.|
plant    70 SSAKRGGDLGSFGRGQMQKPFEEATYALKVGDISDIVDTDSGVHIIKRTA 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dodNP_523428.1 WW 7..39 CDD:197736
PTZ00356 55..166 CDD:185573 60/113 (53%)
PIN1ATNP_179395.1 Rotamase_2 5..119 CDD:421736 60/113 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 116 1.000 Domainoid score I1985
eggNOG 1 0.900 - - E1_COG0760
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4531
Inparanoid 1 1.050 120 1.000 Inparanoid score I1983
OMA 1 1.010 - - QHG56539
OrthoDB 1 1.010 - - D1437969at2759
OrthoFinder 1 1.000 - - FOG0001686
OrthoInspector 1 1.000 - - oto2991
orthoMCL 1 0.900 - - OOG6_100390
Panther 1 1.100 - - LDO PTHR10657
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2519
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.930

Return to query results.
Submit another query.