DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dod and pin4

DIOPT Version :9

Sequence 1:NP_523428.1 Gene:dod / 33111 FlyBaseID:FBgn0015379 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_001018389.1 Gene:pin4 / 553574 ZFINID:ZDB-GENE-050522-117 Length:128 Species:Danio rerio


Alignment Length:145 Identity:38/145 - (26%)
Similarity:57/145 - (39%) Gaps:44/145 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 PAKKAGG------GSAGGGDAPDE---------VHCLHLLVKHKGSRRPSSWREANITRTKEEAQ 89
            |.|..||      .::|.||:..:         |...|:|.:..|.                   
Zfish     2 PPKGKGGKGAKGAAASGSGDSDKKEKAQKGGTAVKVRHILCEKHGK------------------- 47

  Fly    90 LLLEVYRNKIVQQEATFDELARSYSDCSSAKRGGDLGKFGRGQMQAAFEDAAFKLNVNQLSGIVD 154
             .:|....  ::....|.|:|..||: ..|::|||||...||.|...|:||||.|.::.:...|.
Zfish    48 -CMEAMEK--IKSGMRFSEVAAQYSE-DKARQGGDLGWMTRGSMVGPFQDAAFALPISTMDKPVY 108

  Fly   155 SDS------GLHIIL 163
            :|.      |.|||:
Zfish   109 TDPPVKTKFGYHIIM 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dodNP_523428.1 WW 7..39 CDD:197736
PTZ00356 55..166 CDD:185573 31/124 (25%)
pin4NP_001018389.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..34 7/31 (23%)
Rotamase_2 34..128 CDD:298667 31/113 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0760
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.