DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dod and PIN4

DIOPT Version :9

Sequence 1:NP_523428.1 Gene:dod / 33111 FlyBaseID:FBgn0015379 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_001164218.1 Gene:PIN4 / 5303 HGNCID:8992 Length:133 Species:Homo sapiens


Alignment Length:119 Identity:25/119 - (21%)
Similarity:44/119 - (36%) Gaps:39/119 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 GMSYYLNMYTKESQWDQPTEPAK----KAG-GGSAGGGDAPDE-----------VHCLHLLVKHK 68
            |:...|..::.:.|..:.....|    ||| ||:|.|.|:.|:           |...|:|.:..
Human     9 GLVRQLERFSVQQQASKMPPKGKSGSGKAGKGGAASGSDSADKKAQGPKGGGNAVKVRHILCEKH 73

  Fly    69 GSRRPSSWREANITRTKEEAQLLLEVYRNKIVQQEATFDELARSYSDCSSAKRG 122
            |.                    ::|....  ::....|:|:|..||: ..|::|
Human    74 GK--------------------IMEAMEK--LKSGMRFNEVAAQYSE-DKARQG 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dodNP_523428.1 WW 7..39 CDD:197736 3/18 (17%)
PTZ00356 55..166 CDD:185573 13/79 (16%)
PIN4NP_001164218.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0760
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.