powered by:
Protein Alignment dod and PIN4
DIOPT Version :9
Sequence 1: | NP_523428.1 |
Gene: | dod / 33111 |
FlyBaseID: | FBgn0015379 |
Length: | 166 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001164218.1 |
Gene: | PIN4 / 5303 |
HGNCID: | 8992 |
Length: | 133 |
Species: | Homo sapiens |
Alignment Length: | 119 |
Identity: | 25/119 - (21%) |
Similarity: | 44/119 - (36%) |
Gaps: | 39/119 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 20 GMSYYLNMYTKESQWDQPTEPAK----KAG-GGSAGGGDAPDE-----------VHCLHLLVKHK 68
|:...|..::.:.|..:.....| ||| ||:|.|.|:.|: |...|:|.:..
Human 9 GLVRQLERFSVQQQASKMPPKGKSGSGKAGKGGAASGSDSADKKAQGPKGGGNAVKVRHILCEKH 73
Fly 69 GSRRPSSWREANITRTKEEAQLLLEVYRNKIVQQEATFDELARSYSDCSSAKRG 122
|. ::|.... ::....|:|:|..||: ..|::|
Human 74 GK--------------------IMEAMEK--LKSGMRFNEVAAQYSE-DKARQG 104
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
dod | NP_523428.1 |
WW |
7..39 |
CDD:197736 |
3/18 (17%) |
PTZ00356 |
55..166 |
CDD:185573 |
13/79 (16%) |
PIN4 | NP_001164218.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0760 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.