DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dod and PIN1

DIOPT Version :9

Sequence 1:NP_523428.1 Gene:dod / 33111 FlyBaseID:FBgn0015379 Length:166 Species:Drosophila melanogaster
Sequence 2:XP_011526370.1 Gene:PIN1 / 5300 HGNCID:8988 Length:168 Species:Homo sapiens


Alignment Length:163 Identity:83/163 - (50%)
Similarity:99/163 - (60%) Gaps:14/163 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PDAEQLPDGWEKRTSRSTGMSYYLNMYTKESQWDQPTEPAKKAGGGSAGGGDAPDEVHCLHLLVK 66
            ||::..|           |..||.|..|..|||::|:  ...:.||..|.|: |..|.|.|||||
Human    18 PDSDLNP-----------GRVYYFNHITNASQWERPS--GNSSSGGKNGQGE-PARVRCSHLLVK 68

  Fly    67 HKGSRRPSSWREANITRTKEEAQLLLEVYRNKIVQQEATFDELARSYSDCSSAKRGGDLGKFGRG 131
            |..||||||||:..||||||||..|:..|..||...|..|:.||..:|||||||..||||.|.||
Human    69 HSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRG 133

  Fly   132 QMQAAFEDAAFKLNVNQLSGIVDSDSGLHIILR 164
            |||..||||:|.|...::||.|.:|||:|||||
Human   134 QMQKPFEDASFALRTGEMSGPVFTDSGIHIILR 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dodNP_523428.1 WW 7..39 CDD:197736 10/31 (32%)
PTZ00356 55..166 CDD:185573 67/110 (61%)
PIN1XP_011526370.1 WW <25..42 CDD:278809 8/16 (50%)
Rotamase_2 56..167 CDD:298667 67/112 (60%)
SurA <58..164 CDD:223831 62/105 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158846
Domainoid 1 1.000 126 1.000 Domainoid score I5476
eggNOG 1 0.900 - - E1_COG0760
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4531
Inparanoid 1 1.050 178 1.000 Inparanoid score I4028
Isobase 1 0.950 - 0 Normalized mean entropy S623
OMA 1 1.010 - - QHG56539
OrthoDB 1 1.010 - - D1437969at2759
OrthoFinder 1 1.000 - - FOG0001686
OrthoInspector 1 1.000 - - oto89289
orthoMCL 1 0.900 - - OOG6_100390
Panther 1 1.100 - - LDO PTHR10657
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R926
SonicParanoid 1 1.000 - - X2519
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1716.750

Return to query results.
Submit another query.