DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dod and pin1

DIOPT Version :9

Sequence 1:NP_523428.1 Gene:dod / 33111 FlyBaseID:FBgn0015379 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_001008110.1 Gene:pin1 / 493472 XenbaseID:XB-GENE-856254 Length:159 Species:Xenopus tropicalis


Alignment Length:164 Identity:92/164 - (56%)
Similarity:109/164 - (66%) Gaps:7/164 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPDAEQLPDGWEKRTSRSTGMSYYLNMYTKESQWDQPTEPAKKAGGGSAGGGDAPDEVHCLHLLV 65
            |.|.|:||.|||||.|||:|..||.|..|..|||::||.      ||..|.|: |.:|.|.||||
 Frog     1 MADEEKLPPGWEKRMSRSSGRVYYFNHMTNASQWERPTT------GGKNGQGE-PGKVRCSHLLV 58

  Fly    66 KHKGSRRPSSWREANITRTKEEAQLLLEVYRNKIVQQEATFDELARSYSDCSSAKRGGDLGKFGR 130
            ||..||||||||:..|||||:||...:..|..||...:..|:.||..:|||||||.|||||.|||
 Frog    59 KHNQSRRPSSWRQDRITRTKDEALEHINGYIQKIKSGDEDFESLASRFSDCSSAKAGGDLGSFGR 123

  Fly   131 GQMQAAFEDAAFKLNVNQLSGIVDSDSGLHIILR 164
            |.||..||||:|.|...::||.|.:|||:|||||
 Frog   124 GAMQKPFEDASFALRPGEMSGPVFTDSGIHIILR 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dodNP_523428.1 WW 7..39 CDD:197736 19/31 (61%)
PTZ00356 55..166 CDD:185573 65/110 (59%)
pin1NP_001008110.1 WW 7..37 CDD:366073 18/29 (62%)
Rotamase_2 47..158 CDD:391994 65/112 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 123 1.000 Domainoid score I5568
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4531
Inparanoid 1 1.050 147 1.000 Inparanoid score I4301
OMA 1 1.010 - - QHG56539
OrthoDB 1 1.010 - - D1437969at2759
OrthoFinder 1 1.000 - - FOG0001686
OrthoInspector 1 1.000 - - oto103125
Panther 1 1.100 - - LDO PTHR10657
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R926
SonicParanoid 1 1.000 - - X2519
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1313.110

Return to query results.
Submit another query.