DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dod and CG11858

DIOPT Version :9

Sequence 1:NP_523428.1 Gene:dod / 33111 FlyBaseID:FBgn0015379 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_651364.1 Gene:CG11858 / 43044 FlyBaseID:FBgn0039305 Length:130 Species:Drosophila melanogaster


Alignment Length:134 Identity:39/134 - (29%)
Similarity:59/134 - (44%) Gaps:33/134 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 QPTEPAKKAGGGSAGGGDAPDEVHCLHLLVKHKGSRRPSSWREANITRTKEEAQLLLEVYRNKIV 100
            :|....|.||....||    :.|...|:|.:.:|          .||...|:            :
  Fly    19 KPAAEDKSAGKEKKGG----NAVKVRHILCEKQG----------KITEAMEK------------L 57

  Fly   101 QQEATFDELARSYSDCSSAKRGGDLGKFGRGQMQAAFEDAAFKLNVNQLSGIVDSDS------GL 159
            :....|.|:|.:||: ..|::|||||...||.|...|:||||.|.::.::..|.:|.      |.
  Fly    58 KAGQKFPEVAAAYSE-DKARQGGDLGWQIRGAMVGPFQDAAFALPISTVNNPVYTDPPIKTKFGY 121

  Fly   160 HIIL 163
            |||:
  Fly   122 HIIM 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dodNP_523428.1 WW 7..39 CDD:197736 1/2 (50%)
PTZ00356 55..166 CDD:185573 33/115 (29%)
CG11858NP_651364.1 Rotamase_2 28..130 CDD:298667 36/125 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468032
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0760
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.