DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dod and pin1

DIOPT Version :9

Sequence 1:NP_523428.1 Gene:dod / 33111 FlyBaseID:FBgn0015379 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_957042.1 Gene:pin1 / 393721 ZFINID:ZDB-GENE-040426-1714 Length:159 Species:Danio rerio


Alignment Length:164 Identity:94/164 - (57%)
Similarity:114/164 - (69%) Gaps:7/164 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPDAEQLPDGWEKRTSRSTGMSYYLNMYTKESQWDQPTEPAKKAGGGSAGGGDAPDEVHCLHLLV 65
            |.|.|:||.|||||.|||:|..||.|..|..|||::|      :|.|:.|.||. ::|.|.||||
Zfish     1 MSDDEKLPSGWEKRMSRSSGRVYYFNHITNASQWERP------SGSGADGAGDV-EKVRCSHLLV 58

  Fly    66 KHKGSRRPSSWREANITRTKEEAQLLLEVYRNKIVQQEATFDELARSYSDCSSAKRGGDLGKFGR 130
            ||..|||||||||.||||:|:||..|::.|..:|...|..|:.||..:||||||:.|||||.|||
Zfish    59 KHSQSRRPSSWREENITRSKDEALQLIQKYIEQIKSGEEEFESLASQFSDCSSARNGGDLGLFGR 123

  Fly   131 GQMQAAFEDAAFKLNVNQLSGIVDSDSGLHIILR 164
            ||||..||||:|.|.|..:||.|.:|||:|||||
Zfish   124 GQMQKPFEDASFALKVGDMSGPVFTDSGVHIILR 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dodNP_523428.1 WW 7..39 CDD:197736 19/31 (61%)
PTZ00356 55..166 CDD:185573 67/110 (61%)
pin1NP_957042.1 WW 7..37 CDD:278809 18/29 (62%)
PTZ00356 49..159 CDD:185573 67/109 (61%)
SurA <49..155 CDD:223831 63/105 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594799
Domainoid 1 1.000 131 1.000 Domainoid score I5144
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4531
Inparanoid 1 1.050 158 1.000 Inparanoid score I4245
OMA 1 1.010 - - QHG56539
OrthoDB 1 1.010 - - D1437969at2759
OrthoFinder 1 1.000 - - FOG0001686
OrthoInspector 1 1.000 - - oto39678
orthoMCL 1 0.900 - - OOG6_100390
Panther 1 1.100 - - LDO PTHR10657
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2519
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1312.910

Return to query results.
Submit another query.