DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dod and CG32845

DIOPT Version :9

Sequence 1:NP_523428.1 Gene:dod / 33111 FlyBaseID:FBgn0015379 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_728511.1 Gene:CG32845 / 318243 FlyBaseID:FBgn0052845 Length:386 Species:Drosophila melanogaster


Alignment Length:164 Identity:62/164 - (37%)
Similarity:85/164 - (51%) Gaps:5/164 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 QLPDGWEKRTSRSTGMSYYLNMYTKESQWDQP----TEPAKKAGGGSAGG-GDAPDEVHCLHLLV 65
            :||.|||:|.:.||...|:.:..|::..:..|    .|..:.|.|...|. .|..|::.|.|:||
  Fly    72 KLPFGWEERIAHSTKECYFYDTITRKVHFTLPPSHHREKDRNAWGAILGDYSDFNDQLRCRHILV 136

  Fly    66 KHKGSRRPSSWREANITRTKEEAQLLLEVYRNKIVQQEATFDELARSYSDCSSAKRGGDLGKFGR 130
            ||..|.|.||:||..:.|||:||...:...|:.|...:..|.|||...|||.||:.|||||....
  Fly   137 KHSESDRCSSYRERMVRRTKQEALNKIMHARDLIQSGKFEFAELANMISDCCSARHGGDLGPLSL 201

  Fly   131 GQMQAAFEDAAFKLNVNQLSGIVDSDSGLHIILR 164
            .|....||.....|...:||.|..:.:|.||:||
  Fly   202 TQTPFVFERNILLLKDGELSEIFQTKAGYHILLR 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dodNP_523428.1 WW 7..39 CDD:197736 11/35 (31%)
PTZ00356 55..166 CDD:185573 46/110 (42%)
CG32845NP_728511.1 WW 73..103 CDD:278809 10/29 (34%)
Rotamase_2 127..237 CDD:298667 46/109 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468819
Domainoid 1 1.000 55 1.000 Domainoid score I638
eggNOG 1 0.900 - - E1_COG0760
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S623
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D124445at50557
OrthoFinder 1 1.000 - - FOG0001686
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10657
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.800

Return to query results.
Submit another query.