DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dod and Pin1

DIOPT Version :9

Sequence 1:NP_523428.1 Gene:dod / 33111 FlyBaseID:FBgn0015379 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_001100171.1 Gene:Pin1 / 298696 RGDID:1310299 Length:165 Species:Rattus norvegicus


Alignment Length:164 Identity:93/164 - (56%)
Similarity:108/164 - (65%) Gaps:1/164 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPDAEQLPDGWEKRTSRSTGMSYYLNMYTKESQWDQPTEPAKKAGGGSAGGGDAPDEVHCLHLLV 65
            |.|.|:||.|||||.|||:|..||.|..|..|||::|: .....||||..|...|..|.|.||||
  Rat     1 MADEEKLPSGWEKRMSRSSGRVYYFNHITNASQWERPS-GGSTVGGGSKNGQGEPARVRCSHLLV 64

  Fly    66 KHKGSRRPSSWREANITRTKEEAQLLLEVYRNKIVQQEATFDELARSYSDCSSAKRGGDLGKFGR 130
            ||..||||||||:..|||:||||..|:..|..||...|..|:.||..:|||||||..||||.|.|
  Rat    65 KHSQSRRPSSWRQEKITRSKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSR 129

  Fly   131 GQMQAAFEDAAFKLNVNQLSGIVDSDSGLHIILR 164
            ||||..||||:|.|...::||.|.:|||:|||||
  Rat   130 GQMQKPFEDASFALRTGEMSGPVFTDSGIHIILR 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dodNP_523428.1 WW 7..39 CDD:197736 19/31 (61%)
PTZ00356 55..166 CDD:185573 66/110 (60%)
Pin1NP_001100171.1 WW 7..37 CDD:395320 18/29 (62%)
Rotamase_2 53..164 CDD:421736 66/111 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352846
Domainoid 1 1.000 124 1.000 Domainoid score I5409
eggNOG 1 0.900 - - E1_COG0760
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4531
Inparanoid 1 1.050 182 1.000 Inparanoid score I3879
OMA 1 1.010 - - QHG56539
OrthoDB 1 1.010 - - D1437969at2759
OrthoFinder 1 1.000 - - FOG0001686
OrthoInspector 1 1.000 - - oto96412
orthoMCL 1 0.900 - - OOG6_100390
Panther 1 1.100 - - LDO PTHR10657
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2519
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.