DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dod and Pin1rt1

DIOPT Version :9

Sequence 1:NP_523428.1 Gene:dod / 33111 FlyBaseID:FBgn0015379 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_001028940.1 Gene:Pin1rt1 / 241593 MGIID:3649546 Length:159 Species:Mus musculus


Alignment Length:160 Identity:86/160 - (53%)
Similarity:105/160 - (65%) Gaps:6/160 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EQLPDGWEKRTSRSTGMSYYLNMYTKESQWDQPTEPAKKAGGGSAGGGDAPDEVHCLHLLVKHKG 69
            |:||.||:|..|||:|..||.|..|..|||::|:|.:.|.|.|.      |..|.|.||||||..
Mouse     4 EKLPPGWKKYMSRSSGREYYFNHITNASQWERPSEGSSKNGQGE------PARVRCSHLLVKHSQ 62

  Fly    70 SRRPSSWREANITRTKEEAQLLLEVYRNKIVQQEATFDELARSYSDCSSAKRGGDLGKFGRGQMQ 134
            ||||||||:..|||:||||..|:..|..||...|..|:.||..:|||||||..||||.|.||||:
Mouse    63 SRRPSSWRQEKITRSKEEALELINGYIRKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQME 127

  Fly   135 AAFEDAAFKLNVNQLSGIVDSDSGLHIILR 164
            ..||||:|.|...::||.|.::||:|||||
Mouse   128 KPFEDASFALRTGEMSGPVFTESGIHIILR 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dodNP_523428.1 WW 7..39 CDD:197736 17/31 (55%)
PTZ00356 55..166 CDD:185573 64/110 (58%)
Pin1rt1NP_001028940.1 WW 6..36 CDD:366073 16/29 (55%)
Rotamase_2 47..158 CDD:391994 64/117 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849226
Domainoid 1 1.000 124 1.000 Domainoid score I5499
eggNOG 1 0.900 - - E1_COG0760
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 180 1.000 Inparanoid score I3983
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56539
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001686
OrthoInspector 1 1.000 - - otm42955
orthoMCL 1 0.900 - - OOG6_100390
Panther 1 1.100 - - O PTHR10657
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2519
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1211.800

Return to query results.
Submit another query.