DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fliI and RLP38

DIOPT Version :9

Sequence 1:NP_525097.1 Gene:fliI / 33110 FlyBaseID:FBgn0000709 Length:1256 Species:Drosophila melanogaster
Sequence 2:NP_188953.1 Gene:RLP38 / 821887 AraportID:AT3G23120 Length:784 Species:Arabidopsis thaliana


Alignment Length:407 Identity:114/407 - (28%)
Similarity:169/407 - (41%) Gaps:87/407 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VDFTKNDFSATFPSSMRQMSRVQWLTLDRTQL-AEIPEELGHLQKLEHLSLNHNRLE----KIFG 69
            :|.:..:.....|||:..:|.:..|.|....| .|:|..:|:|.:||::.|..|.|.    ..|.
plant   115 LDLSNCNLQGEIPSSIENLSHLTHLDLSTNHLVGEVPASIGNLNQLEYIDLRGNHLRGNIPTSFA 179

  Fly    70 ELTELSCLRSLDLRHNQLKNSGIPPELFHLEELTTLDLSHNKLKE-------------------- 114
            .||:||.   |||..|......|  .|.:|..|..||||.|..|.                    
plant   180 NLTKLSL---LDLHENNFTGGDI--VLSNLTSLAILDLSSNHFKSFFSADLSGLHNLEQIFGNEN 239

  Fly   115 -----VPEGLERAKNLIVLNLSNNQIESIPTPLFIHLTD----LLFLDLSHNR-LETLPPQTRRL 169
                 .|..|.:..:|..:.||.||.|.   |:....|.    |..||:|||. :..:|....:|
plant   240 SFVGLFPASLLKISSLDKIQLSQNQFEG---PIDFGNTSSSSRLTMLDISHNNFIGRVPSSLSKL 301

  Fly   170 INLKTLDLSHNPLELFQLRQLPSLQSLEVLKMSGTQRTLLNF----PTSIDSLANLCELDLSHNS 230
            :||:.||||||                             ||    |.||..|.||..||:|:|.
plant   302 VNLELLDLSHN-----------------------------NFRGLSPRSISKLVNLTSLDISYNK 337

  Fly   231 LP-KLPDCVYNVVTLVRLNLSDNELTELTAGVEL--WQRLESLNLSRNQLVA-LPAALCKLPKLR 291
            |. ::|..::....|..::||.|...:|...||:  ..:|..|||..|.|.. :|..:|....:.
plant   338 LEGQVPYFIWKPSNLQSVDLSHNSFFDLGKSVEVVNGAKLVGLNLGSNSLQGPIPQWICNFRFVF 402

  Fly   292 RLLVNDNKLNFEG-IPSGIGKLGALEVFSAANNLLE-MVPEGLCRCGA-LKQLNLSCNRLI-TLP 352
            .|.::||:  |.| ||..:.........:..||.|. .:|| ||.... |:.|::|.|..: .||
plant   403 FLDLSDNR--FTGSIPQCLKNSTDFNTLNLRNNSLSGFLPE-LCMDSTMLRSLDVSYNNFVGKLP 464

  Fly   353 DAIHLLEGLDQLDLRNN 369
            .::...:.::.|::|.|
plant   465 KSLMNCQDMEFLNVRGN 481

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fliINP_525097.1 leucine-rich repeat 7..30 CDD:275380 4/19 (21%)
leucine-rich repeat 31..53 CDD:275380 7/22 (32%)
LRR_8 53..112 CDD:290566 23/62 (37%)
leucine-rich repeat 54..76 CDD:275380 9/25 (36%)
LRR_RI 70..304 CDD:238064 77/271 (28%)
leucine-rich repeat 77..101 CDD:275380 7/23 (30%)
LRR_8 101..159 CDD:290566 23/87 (26%)
leucine-rich repeat 102..124 CDD:275380 9/46 (20%)
leucine-rich repeat 125..148 CDD:275380 7/22 (32%)
leucine-rich repeat 149..171 CDD:275380 8/22 (36%)
LRR_8 152..231 CDD:290566 27/83 (33%)
leucine-rich repeat 172..195 CDD:275380 7/22 (32%)
leucine-rich repeat 196..220 CDD:275380 6/27 (22%)
leucine-rich repeat 221..243 CDD:275380 7/22 (32%)
LRR_8 243..300 CDD:290566 18/59 (31%)
leucine-rich repeat 244..266 CDD:275380 7/23 (30%)
leucine-rich repeat 267..289 CDD:275380 8/22 (36%)
leucine-rich repeat 290..314 CDD:275380 7/24 (29%)
LRR_8 315..370 CDD:290566 16/58 (28%)
leucine-rich repeat 315..335 CDD:275380 7/20 (35%)
leucine-rich repeat 338..360 CDD:275378 6/22 (27%)
gelsolin_S1_like 491..602 CDD:200446
gelsolin_like 618..706 CDD:200436
gelsolin_S3_like 729..828 CDD:200448
gelsolin_like 920..1015 CDD:200436
gelsolin_S5_like 1037..1141 CDD:200444
gelsolin_S6_like 1151..1250 CDD:200447
RLP38NP_188953.1 PLN00113 11..>721 CDD:331614 114/407 (28%)
leucine-rich repeat 112..135 CDD:275380 4/19 (21%)
leucine-rich repeat 136..159 CDD:275380 7/22 (32%)
leucine-rich repeat 160..183 CDD:275380 7/22 (32%)
leucine-rich repeat 184..206 CDD:275380 9/26 (35%)
leucine-rich repeat 207..254 CDD:275380 9/46 (20%)
leucine-rich repeat 255..276 CDD:275380 8/23 (35%)
leucine-rich repeat 280..303 CDD:275380 8/22 (36%)
leucine-rich repeat 304..327 CDD:275380 13/51 (25%)
leucine-rich repeat 352..376 CDD:275380 7/23 (30%)
leucine-rich repeat 377..397 CDD:275380 7/19 (37%)
leucine-rich repeat 401..424 CDD:275380 7/24 (29%)
leucine-rich repeat 425..448 CDD:275380 7/23 (30%)
leucine-rich repeat 449..472 CDD:275380 6/22 (27%)
leucine-rich repeat 473..496 CDD:275380 3/9 (33%)
leucine-rich repeat 523..545 CDD:275380
leucine-rich repeat 659..682 CDD:275380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.