DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fliI and Capg

DIOPT Version :9

Sequence 1:NP_525097.1 Gene:fliI / 33110 FlyBaseID:FBgn0000709 Length:1256 Species:Drosophila melanogaster
Sequence 2:NP_001035999.1 Gene:Capg / 12332 MGIID:1098259 Length:349 Species:Mus musculus


Alignment Length:349 Identity:106/349 - (30%)
Similarity:160/349 - (45%) Gaps:31/349 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   495 QLPGLTIWEIENFLPNKIEEVVHGKFYEGDCYIVLKTKFDDLGLLDWEIFFWIGNEATLDKRACA 559
            |.|||.||.:|...|..|....||.|:.||.|:||....::..    .:..|||.:::.|::...
Mouse    17 QDPGLHIWRVEKLKPVPIARESHGIFFSGDSYLVLHNGPEEAS----HLHLWIGQQSSRDEQGAC 77

  Fly   560 AIHAVNLRNFLGARCRTVREEQGDESEQFLSLFETEVIYIEGGRTATGFYTIEEMIH-------- 616
            |:.||:|...||.|....||.||:||:.|:|.|...:.|.|||        :|...|        
Mouse    78 AVLAVHLNTLLGERPVQHREVQGNESDLFMSYFPRGLKYREGG--------VESAFHKTTSGATP 134

  Fly   617 --ITRLYLVHAYGATIHLEPVAPAITSLDPRHAFVLDLGTHIYIWMGERSKNTLNSKARLMAEKI 679
              |.:||.|.. ...|.....|.:..|.:....|:||||.:|:.|.|.:|.....:|||.:|..|
Mouse   135 AAIRKLYQVKG-KKNIRATERALSWDSFNTGDCFILDLGQNIFAWCGGKSNILERNKARDLALAI 198

  Fly   680 SKTERKNKCEIQLERQGEESAEFWQGLGMTSEEADAAEPPKEHVPEDYQPVQ-PRLYQVQLGMGY 743
            ..:||:.|.::::...|||.||..|.||  .:.|.....|:|.:..|....| ..||:|....|.
Mouse   199 RDSERQGKAQVEIITDGEEPAEMIQVLG--PKPALKEGNPEEDITADQTNAQAAALYKVSDATGQ 261

  Fly   744 LELPQVELPEQKLCHTLLNSKHVYILD---CYTDLFVWFGKKSTRLVRAAAVKLSRELFNMMDRP 805
            :.|.:| .........||.....::||   | ..:::|.|:|:....|.||::::....:.|...
Mouse   262 MNLTKV-ADSSPFASELLIPDDCFVLDNGLC-GKIYIWKGRKANEKERQAALQVADGFISRMRYS 324

  Fly   806 DYALVMRVPEGNEMQIFRTKFAGW 829
            ....|..:|:|.|..||:..|..|
Mouse   325 PNTQVEILPQGRESPIFKQFFKNW 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fliINP_525097.1 leucine-rich repeat 7..30 CDD:275380
leucine-rich repeat 31..53 CDD:275380
LRR_8 53..112 CDD:290566
leucine-rich repeat 54..76 CDD:275380
LRR_RI 70..304 CDD:238064
leucine-rich repeat 77..101 CDD:275380
LRR_8 101..159 CDD:290566
leucine-rich repeat 102..124 CDD:275380
leucine-rich repeat 125..148 CDD:275380
leucine-rich repeat 149..171 CDD:275380
LRR_8 152..231 CDD:290566
leucine-rich repeat 172..195 CDD:275380
leucine-rich repeat 196..220 CDD:275380
leucine-rich repeat 221..243 CDD:275380
LRR_8 243..300 CDD:290566
leucine-rich repeat 244..266 CDD:275380
leucine-rich repeat 267..289 CDD:275380
leucine-rich repeat 290..314 CDD:275380
LRR_8 315..370 CDD:290566
leucine-rich repeat 315..335 CDD:275380
leucine-rich repeat 338..360 CDD:275378
gelsolin_S1_like 491..602 CDD:200446 39/106 (37%)
gelsolin_like 618..706 CDD:200436 29/87 (33%)
gelsolin_S3_like 729..828 CDD:200448 26/102 (25%)
gelsolin_like 920..1015 CDD:200436
gelsolin_S5_like 1037..1141 CDD:200444
gelsolin_S6_like 1151..1250 CDD:200447
CapgNP_001035999.1 gelsolin_S1_like 17..120 CDD:200446 39/106 (37%)
gelsolin_S2_like 139..226 CDD:200445 29/87 (33%)
gelsolin_S3_like 247..347 CDD:200448 26/101 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1376537at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.