DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1486 and DPL1

DIOPT Version :9

Sequence 1:NP_608450.1 Gene:CG1486 / 33108 FlyBaseID:FBgn0031174 Length:852 Species:Drosophila melanogaster
Sequence 2:NP_174119.1 Gene:DPL1 / 839691 AraportID:AT1G27980 Length:544 Species:Arabidopsis thaliana


Alignment Length:540 Identity:96/540 - (17%)
Similarity:174/540 - (32%) Gaps:191/540 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   348 NSALSAFESDPILSRRLNALSLWTSLQALGRKAIAERLH-VAFQTCSILFEIASKCEGIRVLSHT 411
            ||.||.||  |::...:..:||:.: |.:|  ::...:| ...:.|.|.|.:.       :|...
plant    21 NSRLSEFE--PLVLLLVPLVSLFLA-QIIG--SVFGVVHEKGLKACLIGFIMG-------LLKMI 73

  Fly   412 PGAQTGASLSDVIQSPFDVQALFDAAAPVVAYQFDGSTTIPLGGSGSSAAAAAAERETAE----- 471
            ||                ||...||....|..|..         ||||    :.::...|     
plant    74 PG----------------VQNYIDAEKQKVVDQLQ---------SGSS----SKKKNKTEVLPVK 109

  Fly   472 --GLKPLEKINNASYFDRLNSWLGQILQRDCPNFDF-EVIEHPTHGSCIRYCPLELGLGEQPPSS 533
              |::.|||:.|....|.:  |.|:     |....: ...|...|.|.|               :
plant   110 GLGVEVLEKMENEKRNDAI--WQGK-----CSGTVYIGGAESEGHFSLI---------------N 152

  Fly   534 ENLESFAQSLEAHVDILRATIKHKARFIHLVECSDVLRLVPLPEWAGMGGV--RFVPEGWESLLT 596
            :....||.:...|:|:.::.::.::..:.:...     |:...|.|..|.:  .....|.||   
plant   153 QACSMFAHTNPLHIDVFQSVVRFESEVVAMTAA-----LLGSKETASGGQICGNMTSGGTES--- 209

  Fly   597 DQAKTELNKLNIDLVEALKSTDNAFSLGEGTDGLICVRFGMVTHETEVEELLDLVVTVGKSVQEN 661
                         :|.|:||:.:.....:|     ..|..|:..|:            |.|    
plant   210 -------------IVLAVKSSRDYMKYKKG-----ITRPEMIIPES------------GHS---- 240

  Fly   662 SRVLDTMSEIVKKGIEAVTADLQRESEEKLWQEGILRH-VPVVGRVFNWWSP--------PAKES 717
              ..|..::..|..:..|..|....::.|..:..|.|: :.:||.     :|        |.:|.
plant   241 --AYDKAAQYFKIKLWRVPVDKDFRADVKATRRHINRNTIMIVGS-----APGFPHGIIDPIEEL 298

  Fly   718 GIKGRSLNL-----------------------------TQGVVESTENIYKYHMQMTGATA---- 749
            |....|..:                             .|||...:.:::||.:...|.:.    
plant   299 GQLALSYGICFHVDLCLGGFVLPFARKLGYQIPPFDFSVQGVTSISVDVHKYGLAPKGTSTVLYR 363

  Fly   750 -HQLPANRSPPTPMVQTPVVAPALPPVFPTVEPVPGNGNGSGASEGTPVQSGEASGSMPAASGAA 813
             |::..::                   |..|.      ..||....:|..:|...||:.|.:.||
plant   364 NHEIRKHQ-------------------FVAVT------EWSGGLYVSPTIAGSRPGSLVAGAWAA 403

  Fly   814 PSAAPTQNHVDHARTVSQSS 833
            ..:...:.::.:...:.::|
plant   404 MMSLGEEGYLQNTSKIMEAS 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1486NP_608450.1 AAT_I 159..>384 CDD:302748 11/35 (31%)
WWbp <725..801 CDD:304964 12/109 (11%)
DPL1NP_174119.1 GadA 156..503 CDD:223154 54/342 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR42735
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.