DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1486 and Sply

DIOPT Version :9

Sequence 1:NP_608450.1 Gene:CG1486 / 33108 FlyBaseID:FBgn0031174 Length:852 Species:Drosophila melanogaster
Sequence 2:NP_652032.1 Gene:Sply / 46059 FlyBaseID:FBgn0010591 Length:545 Species:Drosophila melanogaster


Alignment Length:349 Identity:63/349 - (18%)
Similarity:126/349 - (36%) Gaps:106/349 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 DPGQSTPAVAEIAASSIRSGL---------AELELRSS----QVLQRLENVKVSTTPE---SPNP 70
            :|.|    ||.|.|:::..|:         ..|.:|..    :..:::..|:.....|   :.|.
  Fly    25 EPWQ----VATITATTVLGGVWLWTVICQDENLYIRGKRQFFKFAKKIPAVRRQVETELAKAKND 85

  Fly    71 VENE-EEAGERVTSEDLLPAKHRVPSDILKSLEQLVS---YTDSDDDPEFPLPALDDVSHLALIS 131
            .|.| :::...:|..:.||.|.....:||:.:::.:.   |...|                ..:|
  Fly    86 FETEIKKSNAHLTYSETLPEKGLSKEEILRLVDEHLKTGHYNWRD----------------GRVS 134

  Fly   132 HSIVAYLSHLDRQQLLRVTNSISGDATRWLGTLFHFAHPASSFHADNADAVLR----TVRLAI-- 190
            .::..|     :..|:.:...:.|.|:        :.:|   .|||....|.:    .||:|.  
  Fly   135 GAVYGY-----KPDLVELVTEVYGKAS--------YTNP---LHADLFPGVCKMEAEVVRMACNL 183

  Fly   191 ----VARCPGYLEGGIPA-----------------LAQPTFYISENTTPMRLHYACRQLG----I 230
                .|.|.....||..:                 :.:|...:     |..:|.|..:.|    |
  Fly   184 FHGNSASCGTMTTGGTESIVMAMKAYRDFAREYKGITRPNIVV-----PKTVHAAFDKGGQYFNI 243

  Fly   231 PLEAIKVIPEHSQSGTMDVTLLQKQIQQDVGNNRTPLLVVADIGASLCGYVDNLLRLRDVCKAHN 295
            .:.::.|.||..:   :|:...::.|      ||..:|:|........|.:|::..:..:...::
  Fly   244 HVRSVDVDPETYE---VDIKKFKRAI------NRNTILLVGSAPNFPYGTIDDIEAIAALGVKYD 299

  Fly   296 MWLHAS---GHGLAALVCAQNQGH 316
            :.:|..   |..:.|||  :|.|:
  Fly   300 IPVHVDACLGSFVVALV--RNAGY 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1486NP_608450.1 AAT_I 159..>384 CDD:302748 36/192 (19%)
WWbp <725..801 CDD:304964
SplyNP_652032.1 DOPA_deC_like 132..494 CDD:99743 41/222 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445347
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42735
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.