DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dd and NEM1

DIOPT Version :9

Sequence 1:NP_608449.1 Gene:Dd / 33107 FlyBaseID:FBgn0029067 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_011867.1 Gene:NEM1 / 856393 SGDID:S000001046 Length:446 Species:Saccharomyces cerevisiae


Alignment Length:205 Identity:85/205 - (41%)
Similarity:122/205 - (59%) Gaps:18/205 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 LFPLSPVSRHRLSLVQRKTLVLDLDETLIHSHHNAMPRNTVKPGTPHDFTVKVTIDRNPVR--FF 106
            |||...:.:..|:..::|.||:|||||||||    ..|:|....:.....|:|....:.:|  :|
Yeast   235 LFPKKLIPKSVLNTQKKKKLVIDLDETLIHS----ASRSTTHSNSSQGHLVEVKFGLSGIRTLYF 295

  Fly   107 VHKRPHVDYFLDVVSQWYDLVVFTASMEIYGAAVADKLDNG-RNILRRRYYRQHCT-PDYGSYTK 169
            :||||:.|.||..||:||||::|||||:.|...|.|.|::. .:...:||||..|. .|...|.|
Yeast   296 IHKRPYCDLFLTKVSKWYDLIIFTASMKEYADPVIDWLESSFPSSFSKRYYRSDCVLRDGVGYIK 360

  Fly   170 DLSAI----------CSDLNRIFIIDNSPGAYRCFPNNAIPIKSWFSDPMDTALLSLLPMLDALR 224
            |||.:          .|.|:.:.||||||.:|....:|||.::.|.|||.||.||:|||.|:|:|
Yeast   361 DLSIVKDSEENGKGSSSSLDDVIIIDNSPVSYAMNVDNAIQVEGWISDPTDTDLLNLLPFLEAMR 425

  Fly   225 FTNDVRSVLS 234
            ::.|||::|:
Yeast   426 YSTDVRNILA 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DdNP_608449.1 HIF-SF_euk 60..228 CDD:274055 77/181 (43%)
NEM1NP_011867.1 FCP1 9..446 CDD:227517 85/205 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346006
Domainoid 1 1.000 136 1.000 Domainoid score I1074
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002783
OrthoInspector 1 1.000 - - otm46656
orthoMCL 1 0.900 - - OOG6_105071
Panther 1 1.100 - - LDO PTHR12210
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2457
SonicParanoid 1 1.000 - - X1870
TreeFam 1 0.960 - -
1110.730

Return to query results.
Submit another query.