DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dd and TIM50

DIOPT Version :9

Sequence 1:NP_608449.1 Gene:Dd / 33107 FlyBaseID:FBgn0029067 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_015262.1 Gene:TIM50 / 856042 SGDID:S000005984 Length:476 Species:Saccharomyces cerevisiae


Alignment Length:235 Identity:69/235 - (29%)
Similarity:114/235 - (48%) Gaps:46/235 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ISLLQMKFRALLLLLSKVWTCICFMFNRQVRAFIQYQPVKYELFPLSPVSRHRLSLVQRKTLVLD 66
            :||:..:|:|              .||.....|  .:|...:|.|..|...::..|    |||:.
Yeast   153 LSLMYKRFKA--------------RFNSMFTYF--QEPPFPDLLPPPPPPPYQRPL----TLVIT 197

  Fly    67 LDETLIHSHHNAMPRNTVKPGTPHDFTVKVTIDRNPVRFFVHKRPHVDYFLDVVSQWYDLVVFTA 131
            |::.|:||..:.      |.|                 :...|||..||||..:||:|::|:|::
Yeast   198 LEDFLVHSEWSQ------KHG-----------------WRTAKRPGADYFLGYLSQYYEIVLFSS 239

  Fly   132 SMEIYGAAVADKLDNGRNILRRRYYRQHCTPDYGSYTKDLSAICSDLNRIFIIDNSPGAYRCFPN 196
            :..:|...:|:|||.....:....:::||....|.:.||||.:..||:::.|||..|.:|:..|.
Yeast   240 NYMMYSDKIAEKLDPIHAFVSYNLFKEHCVYKDGVHIKDLSKLNRDLSKVIIIDTDPNSYKLQPE 304

  Fly   197 NAIPIKSWFSDPMDTALLSLLPMLD--ALRFTNDVRSVLS 234
            ||||::.| :...|..|:.|:|.|:  |.:.|.|||.:|:
Yeast   305 NAIPMEPW-NGEADDKLVRLIPFLEYLATQQTKDVRPILN 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DdNP_608449.1 HIF-SF_euk 60..228 CDD:274055 53/169 (31%)
TIM50NP_015262.1 FCP1 1..354 CDD:227517 69/235 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.