DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dd and AT1G29780

DIOPT Version :9

Sequence 1:NP_608449.1 Gene:Dd / 33107 FlyBaseID:FBgn0029067 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_174271.1 Gene:AT1G29780 / 839856 AraportID:AT1G29780 Length:221 Species:Arabidopsis thaliana


Alignment Length:235 Identity:81/235 - (34%)
Similarity:129/235 - (54%) Gaps:21/235 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ISLLQMKFRALLLLLSKVWTCICFMFNRQVRAFIQYQPVKYELFPLSPVSRHRLSLVQRKTLVLD 66
            :|:|:...| ||..:|:.:|.|...:......:.:::.::   .||:..:.      .::|::||
plant     1 MSILKFHCR-LLRCVSRCFTGITISYPATKHGYTKFEKLE---DPLTGYTN------MKRTIILD 55

  Fly    67 LDETLIHSHHNAMPRNTVKPGTPHDFTVKVTIDRNPVRFFVHKRPHVDYFLDVVSQWYDLVVFTA 131
            |||||:|:       .|..||..|||.|.|.::|..:..||.|||.|..||:.:.:.|.:|||||
plant    56 LDETLVHA-------TTHLPGVKHDFMVMVKMEREIMPIFVVKRPGVTEFLERLGENYKVVVFTA 113

  Fly   132 SMEIYGAAVADKLD-NGRNILRRRYYRQHCTPDYGSYTKDLSAIC-SDLNRIFIIDNSPGAYRCF 194
            .:|.|.:.|.|||| ||  ::.:|.||..||...|.|.||||.:. .||....|:|::|.:|...
plant   114 GLEEYASQVLDKLDKNG--VISQRLYRDSCTEVNGKYVKDLSLVVGKDLRSALIVDDNPSSYSLQ 176

  Fly   195 PNNAIPIKSWFSDPMDTALLSLLPMLDALRFTNDVRSVLS 234
            |.|.:|||::..|..|..||:|:..|::.....|:|..::
plant   177 PENGVPIKAFVDDLKDQELLNLVEFLESCYAYEDMRDAVT 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DdNP_608449.1 HIF-SF_euk 60..228 CDD:274055 69/169 (41%)
AT1G29780NP_174271.1 HIF-SF_euk 49..210 CDD:274055 69/169 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54256
OrthoDB 1 1.010 - - D1176152at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.