DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dd and AT5G45700

DIOPT Version :9

Sequence 1:NP_608449.1 Gene:Dd / 33107 FlyBaseID:FBgn0029067 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_199382.1 Gene:AT5G45700 / 834609 AraportID:AT5G45700 Length:272 Species:Arabidopsis thaliana


Alignment Length:220 Identity:85/220 - (38%)
Similarity:114/220 - (51%) Gaps:17/220 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 TCICFMFNRQVRAFIQYQPVKYELFPLSPVS----RHRLSLVQ-RKTLVLDLDETLIHSHHNAMP 80
            |.:|.......:.|...:|  .|.|..||.|    |...|..: :||:||||||||:||      
plant    55 TFLCLFSRHATKGFKILKP--REDFQNSPYSLFHERSGKSFDETKKTIVLDLDETLVHS------ 111

  Fly    81 RNTVKPGTPHDFTVKVTIDRNPVRFFVHKRPHVDYFLDVVSQWYDLVVFTASMEIYGAAVADKLD 145
             :..||..|:||.|...||...:.|||.|||.||.||..:.:.|.:|||||.:..|.:.|.||||
plant   112 -SMEKPEVPYDFVVNPKIDGQILTFFVIKRPGVDEFLKKIGEKYQIVVFTAGLREYASLVLDKLD 175

  Fly   146 NGRNILRRRYYRQHCTPDYGSYTKDLSAICSDLNRIFIIDNSPGAYRCFPNNAIPIKSWFSDPMD 210
            ..|.::.|.:||..|:...|...|||..:..||.|:.|:|::|.:|...|.||.|||.:..|..|
plant   176 PERRVISRSFYRDACSEIDGRLVKDLGFVMRDLRRVVIVDDNPNSYALQPENAFPIKPFSDDLED 240

  Fly   211 TALLSLLPML--DALRFTNDVRSVL 233
            ..|..|...|  |.::| .|:|..|
plant   241 VELKKLGEFLYGDCVKF-EDMRVAL 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DdNP_608449.1 HIF-SF_euk 60..228 CDD:274055 71/169 (42%)
AT5G45700NP_199382.1 HIF-SF_euk 97..250 CDD:274055 68/159 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54256
OrthoDB 1 1.010 - - D1176152at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.790

Return to query results.
Submit another query.