DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dd and SSP4b

DIOPT Version :9

Sequence 1:NP_608449.1 Gene:Dd / 33107 FlyBaseID:FBgn0029067 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_001031661.2 Gene:SSP4b / 827539 AraportID:AT4G18140 Length:446 Species:Arabidopsis thaliana


Alignment Length:215 Identity:85/215 - (39%)
Similarity:125/215 - (58%) Gaps:19/215 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 FNRQVRAFIQYQP----VKYELFPLSPVSRHRLSLVQRK--TLVLDLDETLIHSHHNAMPRNTVK 85
            |:.|:  |::.||    |.:..||  .:.:.|.| .:||  ||||||||||:||        |::
plant   234 FDPQI--FLRNQPELADVVFNYFP--DMQQPRDS-PKRKAVTLVLDLDETLVHS--------TLE 285

  Fly    86 PGTPHDFTVKVTIDRNPVRFFVHKRPHVDYFLDVVSQWYDLVVFTASMEIYGAAVADKLDNGRNI 150
            .....||:.:||.:......:|.:||::..||:.|.:.:.:|:||||..||.:.:.|.||.....
plant   286 VCRDTDFSFRVTFNMQENTVYVKQRPYLYRFLERVVELFHVVIFTASHSIYASQLLDILDPDGKF 350

  Fly   151 LRRRYYRQHCTPDYGSYTKDLSAICSDLNRIFIIDNSPGAYRCFPNNAIPIKSWFSDPMDTALLS 215
            :.:|:||..|....|.|||||:.:..||.::.|:||.|..||...||.||||||:.||.|..|::
plant   351 VSQRFYRDSCILSDGIYTKDLTVLGLDLAKVAIVDNCPQVYRLQINNGIPIKSWYDDPTDDGLIT 415

  Fly   216 LLPMLDALRFTNDVRSVLSR 235
            |||.|:.|...||||.|:::
plant   416 LLPFLETLADANDVRPVIAK 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DdNP_608449.1 HIF-SF_euk 60..228 CDD:274055 70/169 (41%)
SSP4bNP_001031661.2 HIF-SF_euk 269..423 CDD:274055 67/161 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1176152at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1004
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.