DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dd and AT3G55960

DIOPT Version :9

Sequence 1:NP_608449.1 Gene:Dd / 33107 FlyBaseID:FBgn0029067 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_191155.1 Gene:AT3G55960 / 824762 AraportID:AT3G55960 Length:305 Species:Arabidopsis thaliana


Alignment Length:196 Identity:64/196 - (32%)
Similarity:102/196 - (52%) Gaps:23/196 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 SLVQRKTLVLDLDETLIHSHHN-----AMPRNTVKPG----------TPHDFTVKVTIDRNPVRF 105
            |..||..:||||||||:.::..     |:....::.|          |..::..|..|  |.|..
plant    93 SRFQRLKVVLDLDETLVCAYETSSLPAALRNQAIEAGLKWFELECLSTDKEYDGKPKI--NYVTV 155

  Fly   106 FVHKRPHVDYFLDVVSQWYDLVVFTASMEIYGAAVADKLDNGRNILRRRYYR-QHCTPDYGSYTK 169
            |  :||.:..||:.:|::.||::|||.:|.|...:.|::|. |.:|..|.|| ...:..|..:.|
plant   156 F--ERPGLHEFLEQLSEFADLILFTAGLEGYARPLVDRIDT-RKVLTNRLYRPSTVSTQYRDHVK 217

  Fly   170 DLSAICSDLNRIFIIDNSPGAYRCFPNNAIPIKSWFS-DPMDTALLS-LLPMLDALRFTNDVRSV 232
            ||.:...::.|..|:||:|.::...|:|.||..::.: .|.||.||. :||:|..|...:|||..
plant   218 DLLSTSKNMCRTVIVDNNPFSFLLQPSNGIPCIAFSAGQPNDTQLLDVILPLLKQLSEEDDVRPT 282

  Fly   233 L 233
            |
plant   283 L 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DdNP_608449.1 HIF-SF_euk 60..228 CDD:274055 58/185 (31%)
AT3G55960NP_191155.1 HAD_like 97..278 CDD:419670 58/185 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1176152at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.